BLASTX nr result
ID: Forsythia22_contig00016052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00016052 (224 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008460205.1| PREDICTED: zinc finger MYM-type protein 1-li... 76 1e-11 ref|XP_008346701.1| PREDICTED: uncharacterized protein LOC103409... 69 2e-09 ref|XP_008358225.1| PREDICTED: zinc finger MYM-type protein 1-li... 68 3e-09 ref|XP_008346700.1| PREDICTED: zinc finger MYM-type protein 1-li... 68 3e-09 ref|XP_008392222.1| PREDICTED: zinc finger MYM-type protein 1-li... 68 3e-09 ref|XP_008392221.1| PREDICTED: zinc finger MYM-type protein 1-li... 68 3e-09 ref|XP_008381526.1| PREDICTED: 52 kDa repressor of the inhibitor... 68 3e-09 ref|XP_008374280.1| PREDICTED: 52 kDa repressor of the inhibitor... 68 3e-09 ref|XP_008374285.1| PREDICTED: 52 kDa repressor of the inhibitor... 67 5e-09 ref|XP_008245511.1| PREDICTED: zinc finger MYM-type protein 1-li... 67 5e-09 ref|XP_007221598.1| hypothetical protein PRUPE_ppa026809mg [Prun... 67 5e-09 ref|XP_008372678.1| PREDICTED: 52 kDa repressor of the inhibitor... 66 8e-09 ref|XP_006489843.1| PREDICTED: zinc finger MYM-type protein 1-li... 66 1e-08 ref|XP_006431141.1| hypothetical protein CICLE_v10013598mg [Citr... 66 1e-08 ref|XP_004298063.1| PREDICTED: zinc finger MYM-type protein 1 [F... 66 1e-08 ref|XP_012844543.1| PREDICTED: uncharacterized protein LOC105964... 65 2e-08 ref|XP_006439348.1| hypothetical protein CICLE_v10023986mg [Citr... 65 2e-08 gb|KDO37473.1| hypothetical protein CISIN_1g037865mg [Citrus sin... 64 5e-08 ref|XP_006421249.1| hypothetical protein CICLE_v10006621mg, part... 64 5e-08 ref|XP_012854489.1| PREDICTED: zinc finger MYM-type protein 1-li... 63 7e-08 >ref|XP_008460205.1| PREDICTED: zinc finger MYM-type protein 1-like [Cucumis melo] Length = 278 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP+ G++ GRD FV EGF NWKKKEKLQ ++ S HNQ + C AL+N+K Sbjct: 111 CYLFKPEVGEQSGRDHFVGEGFSNWKKKEKLQTHVGRPNSAHNQAWGKCDALLNQK 166 >ref|XP_008346701.1| PREDICTED: uncharacterized protein LOC103409667 [Malus domestica] Length = 1071 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 398 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEXHVGGPNSSHNNAWRNCEALLNQK 453 >ref|XP_008358225.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica] Length = 377 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_008346700.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica] Length = 748 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 84 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 139 >ref|XP_008392222.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica] Length = 430 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_008392221.1| PREDICTED: zinc finger MYM-type protein 1-like [Malus domestica] Length = 792 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_008381526.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Malus domestica] Length = 401 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_008374280.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Malus domestica] Length = 792 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/56 (51%), Positives = 41/56 (73%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL+ ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQSGGDTFVGVGFKNWKCKKKLEIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_008374285.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Malus domestica] Length = 869 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K KL+ ++ S HN +R+C+AL+N+K Sbjct: 238 CYLFKPDIGDQSGGDTFVGVGFKNWKCKXKLEIHVGGPNSSHNNAWRNCEALLNQK 293 >ref|XP_008245511.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 788 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP G + G +SFV GF NWKKK++LQ ++ S HN+ +RSC+ L+N++ Sbjct: 116 CYLFKPDVGAQSGGESFVSVGFSNWKKKDRLQIHVGGPNSAHNKAWRSCEVLLNQR 171 >ref|XP_007221598.1| hypothetical protein PRUPE_ppa026809mg [Prunus persica] gi|462418534|gb|EMJ22797.1| hypothetical protein PRUPE_ppa026809mg [Prunus persica] Length = 205 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP G++ G +SFV GF NWKKK++LQ ++ S HN+ +RSC+ L N+K Sbjct: 116 CYLFKPDIGEQLGGESFVGVGFSNWKKKDRLQIHVGGPNSAHNKAWRSCEVLSNQK 171 >ref|XP_008372678.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like [Malus domestica] Length = 792 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP GD+ G D+FV GF+NWK K+KL ++ S HN +R+C+AL+N+K Sbjct: 119 CYLFKPDIGDQXGGDTFVGVGFKNWKCKKKLXIHVGGPNSSHNNAWRNCEALLNQK 174 >ref|XP_006489843.1| PREDICTED: zinc finger MYM-type protein 1-like [Citrus sinensis] Length = 807 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 5/66 (7%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK---- 16 CYLFKP+ G++ G +SF GF NWKK E+L+ ++ S SVHN +RSC+ LM ++ Sbjct: 134 CYLFKPEIGEQAGGESFTKHGFTNWKKPERLRVHVGCSNSVHNDAWRSCQDLMKQEQHIQ 193 Query: 15 -LYTSH 1 +Y+ H Sbjct: 194 TMYSRH 199 >ref|XP_006431141.1| hypothetical protein CICLE_v10013598mg [Citrus clementina] gi|557533198|gb|ESR44381.1| hypothetical protein CICLE_v10013598mg [Citrus clementina] Length = 743 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 5/66 (7%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK---- 16 CYLFKP+ G++ G +SF GF NWKK E+L+ ++ S SVHN +RSC+ LM ++ Sbjct: 89 CYLFKPEIGEQAGGESFTKHGFTNWKKPERLRVHVGCSNSVHNDAWRSCQDLMKQEQHIQ 148 Query: 15 -LYTSH 1 +Y+ H Sbjct: 149 TMYSRH 154 >ref|XP_004298063.1| PREDICTED: zinc finger MYM-type protein 1 [Fragaria vesca subsp. vesca] Length = 827 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = -3 Query: 186 YCYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 +CYLFKP GD+ G D FV GF NWKK+ KL++++ + S HN R C+ L+N++ Sbjct: 154 HCYLFKPDTGDQAGGDVFVGTGFTNWKKRSKLKQHVGRTNSAHNNARRMCEVLLNQR 210 >ref|XP_012844543.1| PREDICTED: uncharacterized protein LOC105964581 [Erythranthe guttatus] Length = 705 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP G + G D FV EGF+NWK+ +KL ++E S HN + C+ LMN+K Sbjct: 264 CYLFKPDIGGQLGGDHFVTEGFKNWKRNDKLSIHVEGPNSAHNIAWGKCQDLMNQK 319 >ref|XP_006439348.1| hypothetical protein CICLE_v10023986mg [Citrus clementina] gi|557541610|gb|ESR52588.1| hypothetical protein CICLE_v10023986mg [Citrus clementina] Length = 781 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = -3 Query: 186 YCYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 +CYLFK GD+ G D+F +GF+NWKKKEKL+ + S HN+ + C+ LMN+K Sbjct: 105 FCYLFKEDNGDQAGSDTFTGKGFKNWKKKEKLKIHEGGVNSAHNRARQKCERLMNQK 161 >gb|KDO37473.1| hypothetical protein CISIN_1g037865mg [Citrus sinensis] Length = 483 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -3 Query: 186 YCYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRKLYT 7 YCY+FK + G + F EGFRNWKKKE L++++ S HN R CK+LMN+K + Sbjct: 39 YCYVFKEENGSQGPGPCFTGEGFRNWKKKEMLRQHVGGVNSAHNIARRHCKSLMNQKAHV 98 Query: 6 S 4 + Sbjct: 99 A 99 >ref|XP_006421249.1| hypothetical protein CICLE_v10006621mg, partial [Citrus clementina] gi|557523122|gb|ESR34489.1| hypothetical protein CICLE_v10006621mg, partial [Citrus clementina] Length = 113 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 5/66 (7%) Frame = -3 Query: 201 SITKN-----YCYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSC 37 S+TK+ YCYLFKP+ GD+ G DSF + NWKKKE L+ +E ++S HNQ + C Sbjct: 23 SVTKDAAFCLYCYLFKPENGDQVGGDSFASKEISNWKKKESLRNMLE-ALSSHNQTWGKC 81 Query: 36 KALMNR 19 + LM + Sbjct: 82 EELMKQ 87 >ref|XP_012854489.1| PREDICTED: zinc finger MYM-type protein 1-like [Erythranthe guttatus] Length = 781 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = -3 Query: 183 CYLFKPQQGDKKGRDSFVVEGFRNWKKKEKLQKYIEDSISVHNQCFRSCKALMNRK 16 CYLFKP G + G D FV EGF+NWK+ +KL ++ S HN + C+ LMN+K Sbjct: 108 CYLFKPDIGGQSGGDHFVTEGFKNWKRNDKLSIHVGGPNSAHNIAWGKCQDLMNQK 163