BLASTX nr result
ID: Forsythia22_contig00014031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00014031 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008236662.1| PREDICTED: zinc finger MYM-type protein 1-li... 59 1e-06 ref|XP_008237438.1| PREDICTED: zinc finger MYM-type protein 1-li... 58 3e-06 >ref|XP_008236662.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 681 Score = 59.3 bits (142), Expect = 1e-06 Identities = 36/103 (34%), Positives = 50/103 (48%), Gaps = 15/103 (14%) Frame = -2 Query: 264 NHLLRRKRKQHSFFKPRIDTPTEDSN---------------PHQHTPPTYNQQFLPTPSS 130 N +R + SFFK + D D++ PH +P QF + Sbjct: 5 NQASKRAKTIDSFFKKKNDGDKLDNDKASTFNDKASPSIESPHHTSPLVEPNQF---DIA 61 Query: 129 DIERDLGKMNNINNYPLNKMDEIKRTYLIAGPYQPKLQEYTAS 1 +ERD GK I+ YP+N+ DE++R Y+ GPYQPKL EY S Sbjct: 62 FLERDPGKRIQISEYPINQHDEVRRAYIKVGPYQPKLSEYPRS 104 >ref|XP_008237438.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 626 Score = 57.8 bits (138), Expect = 3e-06 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 16/101 (15%) Frame = -2 Query: 264 NHLLRRKRKQHSFFKPRID----------------TPTEDSNPHQHTPPTYNQQFLPTPS 133 N +R + SFFK + D +P+ +S PH +P QF Sbjct: 5 NQASKRAKTIDSFFKKKNDGDKLENDKASTFSDKASPSIES-PHHTSPLVEPNQF---DI 60 Query: 132 SDIERDLGKMNNINNYPLNKMDEIKRTYLIAGPYQPKLQEY 10 + +ERD GK I+ YP+N+ DE++R Y+ GPYQPKL EY Sbjct: 61 AFLERDPGKRIQISEYPINQHDEVRRAYIKVGPYQPKLSEY 101