BLASTX nr result
ID: Forsythia22_contig00014011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00014011 (666 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072285.1| PREDICTED: DNA-repair protein XRCC1 [Sesamum... 71 5e-10 >ref|XP_011072285.1| PREDICTED: DNA-repair protein XRCC1 [Sesamum indicum] gi|747052342|ref|XP_011072286.1| PREDICTED: DNA-repair protein XRCC1 [Sesamum indicum] Length = 368 Score = 71.2 bits (173), Expect = 5e-10 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -3 Query: 184 KKRNLPSWMSSRGDKNDDGEDTKQAITHGKAKKDQNALH--SKRGHXXXXXSAAYSGATD 11 +KRNLPSWM+SR ++NDDGE +KQ THGK+ KDQ A H SK A SGA+D Sbjct: 7 RKRNLPSWMNSREEENDDGEKSKQPRTHGKSNKDQKAFHVVSKVAENSGSGFATSSGASD 66 Query: 10 FSK 2 FSK Sbjct: 67 FSK 69