BLASTX nr result
ID: Forsythia22_contig00013437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013437 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071268.1| PREDICTED: putative pentatricopeptide repeat... 164 2e-38 emb|CBI27406.3| unnamed protein product [Vitis vinifera] 151 2e-34 ref|XP_002267299.2| PREDICTED: LOW QUALITY PROTEIN: putative pen... 151 2e-34 ref|XP_006484267.1| PREDICTED: putative pentatricopeptide repeat... 146 5e-33 ref|XP_012855327.1| PREDICTED: putative pentatricopeptide repeat... 145 1e-32 ref|XP_011009314.1| PREDICTED: putative pentatricopeptide repeat... 145 1e-32 ref|XP_009355583.1| PREDICTED: putative pentatricopeptide repeat... 143 4e-32 ref|XP_012478811.1| PREDICTED: putative pentatricopeptide repeat... 143 5e-32 ref|XP_012067072.1| PREDICTED: putative pentatricopeptide repeat... 142 9e-32 ref|XP_008339747.1| PREDICTED: putative pentatricopeptide repeat... 141 2e-31 ref|XP_008339746.1| PREDICTED: putative pentatricopeptide repeat... 141 2e-31 ref|XP_008465042.1| PREDICTED: putative pentatricopeptide repeat... 139 6e-31 ref|XP_002514579.1| pentatricopeptide repeat-containing protein,... 137 4e-30 ref|XP_010030312.1| PREDICTED: putative pentatricopeptide repeat... 135 8e-30 ref|XP_004144470.1| PREDICTED: putative pentatricopeptide repeat... 135 1e-29 emb|CDP00488.1| unnamed protein product [Coffea canephora] 134 3e-29 ref|XP_008231786.1| PREDICTED: putative pentatricopeptide repeat... 132 7e-29 ref|XP_004297191.1| PREDICTED: putative pentatricopeptide repeat... 131 2e-28 ref|XP_008351037.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 130 3e-28 ref|XP_008806671.1| PREDICTED: putative pentatricopeptide repeat... 129 6e-28 >ref|XP_011071268.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Sesamum indicum] Length = 781 Score = 164 bits (416), Expect = 2e-38 Identities = 76/101 (75%), Positives = 90/101 (89%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 +R RAL+ HL +VLQ++G GSAPSLCELL +FRGWDSNHMVWDMLAFVY R+ MVHDAL Sbjct: 81 KRSRALRCHLQRVLQDEGCGSAPSLCELLYKSFRGWDSNHMVWDMLAFVYCRAGMVHDAL 140 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 VL+ MKDL I+PSIMTYNSLLHNLRHTDIMW+VY++I+A+ Sbjct: 141 IVLSNMKDLYIRPSIMTYNSLLHNLRHTDIMWDVYTDIEAN 181 >emb|CBI27406.3| unnamed protein product [Vitis vinifera] Length = 821 Score = 151 bits (381), Expect = 2e-34 Identities = 71/98 (72%), Positives = 87/98 (88%) Frame = +2 Query: 11 RALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVL 190 + L+ L+Q+++E+GSGSAPSLCELLCN+FR WD N++VWDMLA YSR+ MVHDALFVL Sbjct: 132 KELRRVLNQMVEEEGSGSAPSLCELLCNSFRDWDLNNVVWDMLACAYSRAEMVHDALFVL 191 Query: 191 AKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 AKMK L++Q SI TYNSLL+NLRHTDIMW+VY+EIKAS Sbjct: 192 AKMKVLNLQVSIATYNSLLYNLRHTDIMWDVYNEIKAS 229 >ref|XP_002267299.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g13630 [Vitis vinifera] Length = 829 Score = 151 bits (381), Expect = 2e-34 Identities = 71/98 (72%), Positives = 87/98 (88%) Frame = +2 Query: 11 RALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVL 190 + L+ L+Q+++E+GSGSAPSLCELLCN+FR WD N++VWDMLA YSR+ MVHDALFVL Sbjct: 132 KELRRVLNQMVEEEGSGSAPSLCELLCNSFRDWDLNNVVWDMLACAYSRAEMVHDALFVL 191 Query: 191 AKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 AKMK L++Q SI TYNSLL+NLRHTDIMW+VY+EIKAS Sbjct: 192 AKMKVLNLQVSIATYNSLLYNLRHTDIMWDVYNEIKAS 229 >ref|XP_006484267.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630-like [Citrus sinensis] Length = 839 Score = 146 bits (369), Expect = 5e-33 Identities = 68/98 (69%), Positives = 85/98 (86%) Frame = +2 Query: 11 RALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVL 190 + L+ L Q+LQE GSGSAPSLCELL ++FRG++SN VWDMLAFVYSR+ MVHDA+FV+ Sbjct: 137 KGLRLVLEQILQEQGSGSAPSLCELLLHSFRGFESNREVWDMLAFVYSRTGMVHDAVFVI 196 Query: 191 AKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 AKMK+LD++ SI TYNSLL+NLRHTDIMW++Y +IK S Sbjct: 197 AKMKELDLKVSIQTYNSLLYNLRHTDIMWDLYDDIKVS 234 >ref|XP_012855327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Erythranthe guttatus] Length = 828 Score = 145 bits (366), Expect = 1e-32 Identities = 69/100 (69%), Positives = 81/100 (81%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 +R RALQ HL +VL+E+GSGSAP+LCELL +F GWDSN MVWDML FVYSRS+MVHDAL Sbjct: 127 KRSRALQCHLQRVLREEGSGSAPTLCELLSKSFSGWDSNKMVWDMLTFVYSRSDMVHDAL 186 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKA 301 F L KMK+ ++PSIMTYNSLLHNLR D M + Y I+A Sbjct: 187 FALEKMKESRVRPSIMTYNSLLHNLRQRDTMQDFYDSIEA 226 >ref|XP_011009314.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797902|ref|XP_011009321.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797906|ref|XP_011009327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797910|ref|XP_011009335.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797914|ref|XP_011009343.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] gi|743797918|ref|XP_011009349.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Populus euphratica] Length = 832 Score = 145 bits (365), Expect = 1e-32 Identities = 67/101 (66%), Positives = 88/101 (87%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 RR + L+ L Q+LQE+G+GSAP LC+LL ++F+GWDS+++VWDMLAF+YSR MVHDAL Sbjct: 131 RRFKDLRLVLDQMLQEEGTGSAPLLCKLLFSSFKGWDSSNVVWDMLAFIYSRFEMVHDAL 190 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 FVL KMK+ +++PSI TYNSLL+NLRHTDIMW+VY++IK S Sbjct: 191 FVLVKMKEQNLRPSIQTYNSLLYNLRHTDIMWDVYNDIKDS 231 >ref|XP_009355583.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Pyrus x bretschneideri] Length = 834 Score = 143 bits (361), Expect = 4e-32 Identities = 68/101 (67%), Positives = 84/101 (83%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 R+ + L+S + Q++ E+G GSAPSLCEL+ + FR WDS+++VWDMLAF YSRS MVHDAL Sbjct: 134 RQFQELRSVVKQIVDEEGPGSAPSLCELILHGFRDWDSSNVVWDMLAFAYSRSEMVHDAL 193 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 VLAKMKDL+++ S TYN LLHNLRHTDIMWNVY+EIK S Sbjct: 194 SVLAKMKDLNLKVSTSTYNCLLHNLRHTDIMWNVYNEIKDS 234 >ref|XP_012478811.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157866|ref|XP_012478813.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157868|ref|XP_012478814.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157870|ref|XP_012478815.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|823157872|ref|XP_012478816.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Gossypium raimondii] gi|763763272|gb|KJB30526.1| hypothetical protein B456_005G147900 [Gossypium raimondii] Length = 830 Score = 143 bits (360), Expect = 5e-32 Identities = 68/101 (67%), Positives = 83/101 (82%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 RR + L+ + Q+L+E+GSGSAPSLCELL N FR WD +VWDMLAFVYSR MVHDAL Sbjct: 129 RRHKELRFVVEQMLKEEGSGSAPSLCELLLNGFRDWDQKSLVWDMLAFVYSRFEMVHDAL 188 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 +VLAKMKDL ++ SI+TYNSLL+NLRH IMW+VY+EIK + Sbjct: 189 YVLAKMKDLKLRASILTYNSLLYNLRHAYIMWDVYNEIKVA 229 >ref|XP_012067072.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Jatropha curcas] gi|802563781|ref|XP_012067073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Jatropha curcas] Length = 913 Score = 142 bits (358), Expect = 9e-32 Identities = 69/101 (68%), Positives = 81/101 (80%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 RR + L+ L Q+L E+G GSAPSLCELL + F+ WDS+ +VWDMLAF YSRS MVHDAL Sbjct: 213 RRLKELRLVLEQMLLEEGYGSAPSLCELLSSGFKSWDSSDVVWDMLAFAYSRSEMVHDAL 272 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 FVL KMKDL SI TYNSLL+NLRHTDIMW+VY+EIK + Sbjct: 273 FVLVKMKDLKFGASIQTYNSLLYNLRHTDIMWDVYNEIKVN 313 >ref|XP_008339747.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X2 [Malus domestica] Length = 540 Score = 141 bits (355), Expect = 2e-31 Identities = 68/96 (70%), Positives = 79/96 (82%) Frame = +2 Query: 17 LQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVLAK 196 L+S + Q++ E+G GSAPSLCELL FR WDS+ +VWDMLAF YSRS MVHDAL VLAK Sbjct: 139 LRSVVKQMVDEEGPGSAPSLCELLLYRFRDWDSSSVVWDMLAFAYSRSEMVHDALSVLAK 198 Query: 197 MKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 MKDL+++ S TYN LLHNLRHTDIMWNVY+EIK S Sbjct: 199 MKDLNLKVSTSTYNCLLHNLRHTDIMWNVYNEIKDS 234 >ref|XP_008339746.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X1 [Malus domestica] Length = 834 Score = 141 bits (355), Expect = 2e-31 Identities = 68/96 (70%), Positives = 79/96 (82%) Frame = +2 Query: 17 LQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVLAK 196 L+S + Q++ E+G GSAPSLCELL FR WDS+ +VWDMLAF YSRS MVHDAL VLAK Sbjct: 139 LRSVVKQMVDEEGPGSAPSLCELLLYRFRDWDSSSVVWDMLAFAYSRSEMVHDALSVLAK 198 Query: 197 MKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 MKDL+++ S TYN LLHNLRHTDIMWNVY+EIK S Sbjct: 199 MKDLNLKVSTSTYNCLLHNLRHTDIMWNVYNEIKDS 234 >ref|XP_008465042.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130191|ref|XP_008465043.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130193|ref|XP_008465044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130195|ref|XP_008465045.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130197|ref|XP_008465046.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] gi|659130199|ref|XP_008465047.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis melo] Length = 828 Score = 139 bits (351), Expect = 6e-31 Identities = 64/100 (64%), Positives = 79/100 (79%) Frame = +2 Query: 5 RPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALF 184 R + L S + +++E G GSA + C+LL N FR WDSN +VWDMLAF YSR M+HDALF Sbjct: 130 RFKELHSVIKHLIEEQGLGSASTFCDLLLNKFRNWDSNGVVWDMLAFAYSRHEMIHDALF 189 Query: 185 VLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 V AKMKDL++Q S+ TYNSLLHNLRHTDI+W+VY+EIK S Sbjct: 190 VFAKMKDLNLQASVPTYNSLLHNLRHTDIIWDVYNEIKVS 229 >ref|XP_002514579.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546183|gb|EEF47685.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 840 Score = 137 bits (344), Expect = 4e-30 Identities = 67/101 (66%), Positives = 81/101 (80%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 +R L+ L Q+L +GSGSAPSLCELL +FR WDS+++VWDMLA YSRS MVHDAL Sbjct: 140 KRLNELRLVLDQMLLHEGSGSAPSLCELLLGSFRSWDSSNVVWDMLACAYSRSAMVHDAL 199 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 FVL KMKDL+ SI TYNSLL+NLRH++IMW+VY+EIK S Sbjct: 200 FVLVKMKDLNFIVSIQTYNSLLYNLRHSNIMWDVYNEIKVS 240 >ref|XP_010030312.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Eucalyptus grandis] Length = 826 Score = 135 bits (341), Expect = 8e-30 Identities = 62/92 (67%), Positives = 79/92 (85%) Frame = +2 Query: 29 LHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVLAKMKDL 208 L Q+++E+GSGSAP+LCE+L ++F W+ + +VWD+LAF YSR+ MVHDALFVLAKMKD Sbjct: 135 LQQIVEEEGSGSAPALCEVLLSSFCDWELSGVVWDVLAFAYSRAGMVHDALFVLAKMKDS 194 Query: 209 DIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 ++ S TYNSLLHNLRHTDIMW+VY+EIKAS Sbjct: 195 RLRASTTTYNSLLHNLRHTDIMWDVYNEIKAS 226 >ref|XP_004144470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Cucumis sativus] gi|700203290|gb|KGN58423.1| hypothetical protein Csa_3G642640 [Cucumis sativus] Length = 830 Score = 135 bits (340), Expect = 1e-29 Identities = 62/100 (62%), Positives = 77/100 (77%) Frame = +2 Query: 5 RPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALF 184 R + L S + ++ + G GSA +C+LL FR WDSN +VWDMLAF YSR M+HDALF Sbjct: 132 RFKELDSVIKNLIVDQGLGSASIICDLLLEKFRNWDSNGLVWDMLAFAYSRHEMIHDALF 191 Query: 185 VLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 V+AKMKDL+ Q S+ TYNSLLHN+RHTDIMW+VY+EIK S Sbjct: 192 VIAKMKDLNFQASVPTYNSLLHNMRHTDIMWDVYNEIKVS 231 >emb|CDP00488.1| unnamed protein product [Coffea canephora] Length = 843 Score = 134 bits (336), Expect = 3e-29 Identities = 68/100 (68%), Positives = 79/100 (79%) Frame = +2 Query: 5 RPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALF 184 R RAL+ HL Q++ +GSGSAPSLCELL N FR D +H VWDMLAF YSRS MVHDALF Sbjct: 133 RFRALKLHLLQMVHLEGSGSAPSLCELLSNGFRESDFSHTVWDMLAFAYSRSGMVHDALF 192 Query: 185 VLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 VL KMKDL++Q SIMT N LL+NLR TD+MW++ IKAS Sbjct: 193 VLFKMKDLNVQASIMTLNGLLYNLRLTDVMWDMNDVIKAS 232 >ref|XP_008231786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Prunus mume] Length = 805 Score = 132 bits (333), Expect = 7e-29 Identities = 63/98 (64%), Positives = 77/98 (78%) Frame = +2 Query: 11 RALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALFVL 190 + L+ + Q++ E+G GSA SLCELL + FR WDS+ +VWDMLAF YSRS M+HDAL VL Sbjct: 108 KELRLFVKQMVDEEGPGSAHSLCELLLHRFRDWDSSGVVWDMLAFAYSRSEMIHDALSVL 167 Query: 191 AKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 A+MKDL++ S TYN LLHNLRHTDIMW+VY EIK S Sbjct: 168 ARMKDLNLNVSTPTYNCLLHNLRHTDIMWSVYDEIKDS 205 >ref|XP_004297191.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 [Fragaria vesca subsp. vesca] Length = 827 Score = 131 bits (330), Expect = 2e-28 Identities = 65/101 (64%), Positives = 79/101 (78%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 RR L+ + Q+++E+GSGSA SLCELL + FR W S+ +VWD+LAF YSRS MV+DAL Sbjct: 129 RRFEELRLVMKQMVKEEGSGSATSLCELLLSRFRDWGSSGVVWDVLAFSYSRSEMVYDAL 188 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKAS 304 VLAKMKDL+++ S TYN LLHNLRHTDIMWNVY IK S Sbjct: 189 TVLAKMKDLNLRVSTSTYNCLLHNLRHTDIMWNVYDAIKES 229 >ref|XP_008351037.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g13630, partial [Malus domestica] Length = 641 Score = 130 bits (327), Expect = 3e-28 Identities = 63/99 (63%), Positives = 77/99 (77%) Frame = +2 Query: 2 RRPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDAL 181 R+ + L+S + Q++ E+G G APSLCELL FR WDS +VWD LAF YSRS MVHDAL Sbjct: 140 RQFQELRSVVKQMVDEEGPGFAPSLCELLLRRFRDWDSISVVWDTLAFAYSRSEMVHDAL 199 Query: 182 FVLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIK 298 VLAKM+DL+++ S TYN LLHNLRHTD MWNVY+EI+ Sbjct: 200 SVLAKMRDLNLKVSTSTYNCLLHNLRHTDNMWNVYNEIE 238 >ref|XP_008806671.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X3 [Phoenix dactylifera] gi|672173106|ref|XP_008806673.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g13630 isoform X3 [Phoenix dactylifera] Length = 643 Score = 129 bits (325), Expect = 6e-28 Identities = 59/99 (59%), Positives = 78/99 (78%) Frame = +2 Query: 5 RPRALQSHLHQVLQEDGSGSAPSLCELLCNTFRGWDSNHMVWDMLAFVYSRSNMVHDALF 184 R + + S L Q+L E+GSGSAPS CELL N FR WDS +VWDML +YSR M+HDAL+ Sbjct: 112 RLKEINSVLQQMLHEEGSGSAPSFCELLQNNFRDWDSCSIVWDMLTNIYSRLEMIHDALY 171 Query: 185 VLAKMKDLDIQPSIMTYNSLLHNLRHTDIMWNVYSEIKA 301 VL+KM L++Q SI TY+SL++NLRHTD++W++Y EI+A Sbjct: 172 VLSKMDSLNMQASISTYDSLMYNLRHTDMVWDIYKEIRA 210