BLASTX nr result
ID: Forsythia22_contig00013362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013362 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095949.1| PREDICTED: cytochrome b561 and DOMON domain-... 68 3e-09 ref|XP_009775507.1| PREDICTED: cytochrome b561 and DOMON domain-... 65 2e-08 ref|XP_009618415.1| PREDICTED: cytochrome b561 and DOMON domain-... 65 2e-08 ref|XP_011086240.1| PREDICTED: cytochrome b561 and DOMON domain-... 56 8e-06 >ref|XP_011095949.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At4g17280 [Sesamum indicum] Length = 396 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 122 MLRAVLISCVLFSLYLSSYAQSCAKYNFASNQLFSSCNDL 3 M R VLI +LFSLY++S+AQSCAKYNFASNQ+FSSCNDL Sbjct: 1 MSRTVLIISILFSLYITSHAQSCAKYNFASNQIFSSCNDL 40 >ref|XP_009775507.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana sylvestris] Length = 404 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -3 Query: 122 MLRAVLISCVLFSLYLSS-YAQSCAKYNFASNQLFSSCNDL 3 MLR LISC+LFSL++SS YAQSC KYNF SNQ+F+SC+DL Sbjct: 1 MLRVFLISCILFSLFVSSTYAQSCTKYNFTSNQIFTSCSDL 41 >ref|XP_009618415.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana tomentosiformis] Length = 400 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -3 Query: 122 MLRAVLISCVLFSLYLSS-YAQSCAKYNFASNQLFSSCNDL 3 MLR LISC+LFSL++SS YAQSC KYNF SNQ+F+SC+DL Sbjct: 1 MLRGFLISCILFSLFVSSTYAQSCTKYNFTSNQIFTSCSDL 41 >ref|XP_011086240.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Sesamum indicum] Length = 400 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/41 (65%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 122 MLRAVLISCVLFSLYLSS-YAQSCAKYNFASNQLFSSCNDL 3 MLR VL+ V+FSLY+SS Y+Q C KYNFA NQ+FSSC+ L Sbjct: 1 MLRPVLLFSVMFSLYISSSYSQPCEKYNFAGNQIFSSCSSL 41