BLASTX nr result
ID: Forsythia22_contig00013232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013232 (572 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082676.1| PREDICTED: cytochrome c oxidase copper chape... 132 1e-28 emb|CDP05919.1| unnamed protein product [Coffea canephora] 129 7e-28 ref|XP_009356812.1| PREDICTED: cytochrome c oxidase copper chape... 122 9e-26 ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chape... 121 2e-25 ref|XP_009626764.1| PREDICTED: cytochrome c oxidase copper chape... 121 2e-25 ref|XP_002531715.1| Cytochrome c oxidase copper chaperone, putat... 120 4e-25 ref|XP_010112978.1| Cytochrome c oxidase copper chaperone [Morus... 119 9e-25 ref|XP_009341066.1| PREDICTED: cytochrome c oxidase copper chape... 119 9e-25 ref|XP_012084961.1| PREDICTED: cytochrome c oxidase copper chape... 119 9e-25 ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chape... 119 1e-24 ref|XP_008386175.1| PREDICTED: cytochrome c oxidase copper chape... 118 2e-24 ref|XP_008226635.1| PREDICTED: cytochrome c oxidase copper chape... 118 2e-24 ref|XP_007212850.1| hypothetical protein PRUPE_ppa021425mg [Prun... 117 4e-24 ref|XP_008452259.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c... 117 5e-24 ref|XP_006582175.1| PREDICTED: cytochrome c oxidase copper chape... 117 5e-24 ref|XP_007152970.1| hypothetical protein PHAVU_004G175600g [Phas... 117 5e-24 ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chape... 117 5e-24 ref|XP_009761254.1| PREDICTED: cytochrome c oxidase copper chape... 116 6e-24 ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citr... 116 6e-24 ref|XP_011461813.1| PREDICTED: cytochrome c oxidase copper chape... 115 1e-23 >ref|XP_011082676.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Sesamum indicum] gi|747071599|ref|XP_011082679.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Sesamum indicum] Length = 80 Score = 132 bits (332), Expect = 1e-28 Identities = 65/80 (81%), Positives = 71/80 (88%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQSQRDQ-GSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGL ++NSSS+VSLQSQ+DQ GS V A DSKPKK ICCACPDTKKLRDECIVEHGE+ Sbjct: 1 MGGLSIQNSSSIVSLQSQKDQQGSTAVTSAPDSKPKKKICCACPDTKKLRDECIVEHGES 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 ACEKWIEAHR+ LRAEGFNV Sbjct: 61 ACEKWIEAHRKFLRAEGFNV 80 >emb|CDP05919.1| unnamed protein product [Coffea canephora] Length = 79 Score = 129 bits (325), Expect = 7e-28 Identities = 59/79 (74%), Positives = 66/79 (83%), Gaps = 1/79 (1%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQSQRDQGSATVAPASDSKP-KKICCACPDTKKLRDECIVEHGETA 274 MGGLP +NSSSV+SL +DQ +V P DSKP KKICCACP+TKKLRDEC+VEHGE A Sbjct: 1 MGGLPAQNSSSVISLNVHKDQSPGSVGPGPDSKPRKKICCACPETKKLRDECVVEHGEAA 60 Query: 273 CEKWIEAHRRCLRAEGFNV 217 C KWIEAHR+CLRAEGFNV Sbjct: 61 CGKWIEAHRKCLRAEGFNV 79 >ref|XP_009356812.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Pyrus x bretschneideri] gi|694332349|ref|XP_009356813.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Pyrus x bretschneideri] Length = 80 Score = 122 bits (307), Expect = 9e-26 Identities = 59/80 (73%), Positives = 67/80 (83%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP +N+SS + LQ SQ +QGSA PA D+KPKK ICCACPDTKKLRDECIVEHG+ Sbjct: 1 MGGLPAENTSSALVLQRSQPNQGSAVTTPALDTKPKKKICCACPDTKKLRDECIVEHGQD 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWI+AH +CLRAEGFNV Sbjct: 61 ACTKWIDAHLKCLRAEGFNV 80 >ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|449431846|ref|XP_004133711.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|778676325|ref|XP_011650564.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Cucumis sativus] gi|700201111|gb|KGN56244.1| Cytochrome c oxidase copper chaperone [Cucumis sativus] Length = 80 Score = 121 bits (304), Expect = 2e-25 Identities = 58/80 (72%), Positives = 65/80 (81%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSL-QSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP+ NSSS ++L +S+ DQ S + D KPKK ICCACPDTKKLRDECIVEHGE Sbjct: 1 MGGLPVVNSSSAIALPESKLDQASTVIKSTPDGKPKKKICCACPDTKKLRDECIVEHGEE 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR+CLRAEGFNV Sbjct: 61 ACGKWIEAHRKCLRAEGFNV 80 >ref|XP_009626764.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Nicotiana tomentosiformis] gi|697145272|ref|XP_009626766.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Nicotiana tomentosiformis] Length = 76 Score = 121 bits (303), Expect = 2e-25 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSL-QSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP++N+S+ +SL Q +DQ SA DSKPKK ICCACPDTKKLRDECIVEHGE+ Sbjct: 1 MGGLPIENTSTAISLSQVPKDQKSAV----PDSKPKKKICCACPDTKKLRDECIVEHGES 56 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 ACEKWIEAHR+CLRAEGFNV Sbjct: 57 ACEKWIEAHRKCLRAEGFNV 76 >ref|XP_002531715.1| Cytochrome c oxidase copper chaperone, putative [Ricinus communis] gi|223528658|gb|EEF30674.1| Cytochrome c oxidase copper chaperone, putative [Ricinus communis] Length = 80 Score = 120 bits (301), Expect = 4e-25 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLPL+++SS ++L S++++GSA +SKPKK ICCACPDTKKLRDECIVEHGE+ Sbjct: 1 MGGLPLQSASSTLALSGSEQNKGSAITPSVPESKPKKKICCACPDTKKLRDECIVEHGES 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR+CLRAEGFNV Sbjct: 61 ACAKWIEAHRQCLRAEGFNV 80 >ref|XP_010112978.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|703162551|ref|XP_010113080.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|587948910|gb|EXC35137.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|587978046|gb|EXC62695.1| Cytochrome c oxidase copper chaperone [Morus notabilis] Length = 80 Score = 119 bits (298), Expect = 9e-25 Identities = 56/80 (70%), Positives = 67/80 (83%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSL-QSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP +N+SS ++L SQ++ GS P +D+KPKK ICCACP+TKKLRDECIVEHGE Sbjct: 1 MGGLPTENTSSTLALIGSQQNHGSTVNKPGTDTKPKKKICCACPETKKLRDECIVEHGEE 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR+CLR+EGFNV Sbjct: 61 ACAKWIEAHRKCLRSEGFNV 80 >ref|XP_009341066.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Pyrus x bretschneideri] gi|694318063|ref|XP_009341075.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Pyrus x bretschneideri] gi|694318066|ref|XP_009341085.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Pyrus x bretschneideri] Length = 80 Score = 119 bits (298), Expect = 9e-25 Identities = 57/80 (71%), Positives = 66/80 (82%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP +N+SS + L+ SQ + GSA PA D+KPKK ICCACPDTKKLRDECIVEHG+ Sbjct: 1 MGGLPAENTSSALVLKGSQPNHGSAVTTPALDTKPKKKICCACPDTKKLRDECIVEHGQD 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWI+AH +CLRAEGFNV Sbjct: 61 ACTKWIDAHLKCLRAEGFNV 80 >ref|XP_012084961.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Jatropha curcas] gi|802716325|ref|XP_012084962.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Jatropha curcas] gi|643714555|gb|KDP27058.1| hypothetical protein JCGZ_20993 [Jatropha curcas] Length = 80 Score = 119 bits (298), Expect = 9e-25 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLPL+N+SS ++L S++++GSA ++KPKK ICCACP+TKKLRDECIVEHGE+ Sbjct: 1 MGGLPLQNASSTLALPGSEQNKGSAITTSLPETKPKKKICCACPETKKLRDECIVEHGES 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR+CLRAEGFNV Sbjct: 61 ACAKWIEAHRQCLRAEGFNV 80 >ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum tuberosum] Length = 79 Score = 119 bits (297), Expect = 1e-24 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 1/79 (1%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGETA 274 MGGLP++N+S+ +SL +T + DSKPKK ICCACP+TKKLRDECIVEHGE+A Sbjct: 1 MGGLPIENTSTTISLSKLPKDQKSTASTMPDSKPKKKICCACPETKKLRDECIVEHGESA 60 Query: 273 CEKWIEAHRRCLRAEGFNV 217 CEKWIEAHR+CLRAEGF V Sbjct: 61 CEKWIEAHRKCLRAEGFKV 79 >ref|XP_008386175.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Malus domestica] gi|657988017|ref|XP_008386176.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Malus domestica] Length = 80 Score = 118 bits (295), Expect = 2e-24 Identities = 57/80 (71%), Positives = 66/80 (82%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP + +SS + L+ SQ +QGSA PA D+KPKK ICCACPDTKKLRDECIVEHG+ Sbjct: 1 MGGLPAEYTSSALVLKGSQPNQGSAVTTPALDTKPKKKICCACPDTKKLRDECIVEHGQD 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWI+AH +CLRAEGFNV Sbjct: 61 ACTKWIDAHLKCLRAEGFNV 80 >ref|XP_008226635.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Prunus mume] Length = 81 Score = 118 bits (295), Expect = 2e-24 Identities = 58/81 (71%), Positives = 68/81 (83%), Gaps = 3/81 (3%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSA-TVAPASDSKPKK-ICCACPDTKKLRDECIVEHGE 280 MGG+P +N+SS ++ SQ +QGSA T AP+ D+KPKK ICCACPDTKKLRDECIVEHG+ Sbjct: 1 MGGMPTENTSSALAFPGSQPNQGSAVTTAPSLDTKPKKKICCACPDTKKLRDECIVEHGQ 60 Query: 279 TACEKWIEAHRRCLRAEGFNV 217 AC KWI+AH RCLRAEGFNV Sbjct: 61 EACTKWIDAHLRCLRAEGFNV 81 >ref|XP_007212850.1| hypothetical protein PRUPE_ppa021425mg [Prunus persica] gi|462408715|gb|EMJ14049.1| hypothetical protein PRUPE_ppa021425mg [Prunus persica] Length = 81 Score = 117 bits (293), Expect = 4e-24 Identities = 58/81 (71%), Positives = 67/81 (82%), Gaps = 3/81 (3%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSA-TVAPASDSKPKK-ICCACPDTKKLRDECIVEHGE 280 MGG+P +N+SS ++ SQ QGSA T AP+ D+KPKK ICCACPDTKKLRDECIVEHG+ Sbjct: 1 MGGMPTENTSSALAFPGSQPTQGSAVTTAPSLDTKPKKKICCACPDTKKLRDECIVEHGQ 60 Query: 279 TACEKWIEAHRRCLRAEGFNV 217 AC KWI+AH RCLRAEGFNV Sbjct: 61 EACTKWIDAHLRCLRAEGFNV 81 >ref|XP_008452259.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome c oxidase copper chaperone 2-like [Cucumis melo] Length = 79 Score = 117 bits (292), Expect = 5e-24 Identities = 56/79 (70%), Positives = 62/79 (78%), Gaps = 1/79 (1%) Frame = -3 Query: 450 MGGLPLKNSSSVVSL-QSQRDQGSATVAPASDSKPKKICCACPDTKKLRDECIVEHGETA 274 MGGLP+ NSSS ++L +S+ DQ S V KKICCACPDTKKLRDECIVEHGE A Sbjct: 1 MGGLPVVNSSSAIALPESKLDQASTVVKSPRWKTKKKICCACPDTKKLRDECIVEHGEEA 60 Query: 273 CEKWIEAHRRCLRAEGFNV 217 C KWIEAHR+CLRAEGFNV Sbjct: 61 CGKWIEAHRKCLRAEGFNV 79 >ref|XP_006582175.1| PREDICTED: cytochrome c oxidase copper chaperone 1 isoform X2 [Glycine max] Length = 98 Score = 117 bits (292), Expect = 5e-24 Identities = 56/81 (69%), Positives = 68/81 (83%), Gaps = 2/81 (2%) Frame = -3 Query: 453 TMGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGE 280 TM G L+++S +++Q SQ++ GS VA A++SKPKK ICCACPDTK+LRDECIVEHGE Sbjct: 18 TMSGAQLQSASPALTIQGSQKNVGSVAVATAAESKPKKKICCACPDTKRLRDECIVEHGE 77 Query: 279 TACEKWIEAHRRCLRAEGFNV 217 +AC KWIEAHR CLRAEGFNV Sbjct: 78 SACTKWIEAHRLCLRAEGFNV 98 >ref|XP_007152970.1| hypothetical protein PHAVU_004G175600g [Phaseolus vulgaris] gi|561026279|gb|ESW24964.1| hypothetical protein PHAVU_004G175600g [Phaseolus vulgaris] Length = 80 Score = 117 bits (292), Expect = 5e-24 Identities = 55/80 (68%), Positives = 68/80 (85%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 M G L+++SS ++Q SQ+++GSAT A +++KPKK ICCACPDTK+LRDECIVEHGE+ Sbjct: 1 MSGAQLQSASSAFAIQGSQKNEGSATTATGAETKPKKKICCACPDTKRLRDECIVEHGES 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR CLRAEGFNV Sbjct: 61 ACAKWIEAHRLCLRAEGFNV 80 >ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|460405601|ref|XP_004248264.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|723734545|ref|XP_010327136.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] gi|723734550|ref|XP_010327137.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum lycopersicum] Length = 79 Score = 117 bits (292), Expect = 5e-24 Identities = 53/79 (67%), Positives = 63/79 (79%), Gaps = 1/79 (1%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGETA 274 MGGLP++N+S+ +SL + + DSKPKK ICCACP+TKKLRDECIVEHGE+A Sbjct: 1 MGGLPIENTSTTISLSKLPKDQKSAASTMPDSKPKKKICCACPETKKLRDECIVEHGESA 60 Query: 273 CEKWIEAHRRCLRAEGFNV 217 CEKWIEAHR+CLRAEGF V Sbjct: 61 CEKWIEAHRKCLRAEGFKV 79 >ref|XP_009761254.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Nicotiana sylvestris] gi|698528845|ref|XP_009761255.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Nicotiana sylvestris] Length = 80 Score = 116 bits (291), Expect = 6e-24 Identities = 56/80 (70%), Positives = 66/80 (82%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSL-QSQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLP++++S +SL Q +D+ SA +D KPKK ICCACP+TKKLRDECIVEHGE+ Sbjct: 1 MGGLPIESTSMAISLSQLPKDEKSAPSTVPADKKPKKKICCACPETKKLRDECIVEHGES 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 ACEKWIEAHR CLRAEGFNV Sbjct: 61 ACEKWIEAHRICLRAEGFNV 80 >ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] gi|568820489|ref|XP_006464748.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Citrus sinensis] gi|557555081|gb|ESR65095.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] gi|641843589|gb|KDO62488.1| hypothetical protein CISIN_1g045334mg [Citrus sinensis] Length = 80 Score = 116 bits (291), Expect = 6e-24 Identities = 56/80 (70%), Positives = 66/80 (82%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQ-SQRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGLPL+++SS ++L SQ +QG ++SKPKK ICCACP+TKKLRDECIVEHGE Sbjct: 1 MGGLPLQDASSTLALPGSQPNQGLEVTKSGTESKPKKKICCACPETKKLRDECIVEHGEE 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAHR+CLRAEGFNV Sbjct: 61 ACAKWIEAHRKCLRAEGFNV 80 >ref|XP_011461813.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Fragaria vesca subsp. vesca] Length = 80 Score = 115 bits (289), Expect = 1e-23 Identities = 55/80 (68%), Positives = 66/80 (82%), Gaps = 2/80 (2%) Frame = -3 Query: 450 MGGLPLKNSSSVVSLQS-QRDQGSATVAPASDSKPKK-ICCACPDTKKLRDECIVEHGET 277 MGGL +N+SS ++L + Q +QGSA +SD+KPKK ICCACPDTKKLRDECIV+HGE Sbjct: 1 MGGLVTENTSSALALPAMQPNQGSAVANSSSDTKPKKKICCACPDTKKLRDECIVQHGED 60 Query: 276 ACEKWIEAHRRCLRAEGFNV 217 AC KWIEAH+ CLRAEGFN+ Sbjct: 61 ACSKWIEAHKTCLRAEGFNI 80