BLASTX nr result
ID: Forsythia22_contig00013104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013104 (789 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097333.1| PREDICTED: uncharacterized protein LOC105176... 77 1e-11 ref|XP_004231816.1| PREDICTED: histone H3.v1-like [Solanum lycop... 52 2e-06 >ref|XP_011097333.1| PREDICTED: uncharacterized protein LOC105176285 [Sesamum indicum] Length = 546 Score = 77.0 bits (188), Expect = 1e-11 Identities = 56/135 (41%), Positives = 71/135 (52%), Gaps = 16/135 (11%) Frame = +1 Query: 277 SKSLIARQNNLQSPPLSTPVIVPEE-----REQKFKEKFDAEEMP--------KEKTGRK 417 SKSL A +N LQSP LSTP I+ E R+QK +EKF+A EM KEK G + Sbjct: 382 SKSLTACRNRLQSPTLSTPFILRTEERAAKRKQKLEEKFNANEMQKAQLQKTLKEKAGNE 441 Query: 418 FRKEHRIFCFKA*YLQG---KRSMKASDEKESRGPTSVSVLGRTH*SKAHGTISVPPTPS 588 FRK FCFKA L +R + K++ +VLGR +K GTIS+PP P Sbjct: 442 FRKLGCGFCFKARPLPDFYKERETSVNQMKKTPARAQPAVLGRNISTKTRGTISMPPPPP 501 Query: 589 TSLVKTTPCPQNNIS 633 T P+N +S Sbjct: 502 ----PPTSLPKNRVS 512 >ref|XP_004231816.1| PREDICTED: histone H3.v1-like [Solanum lycopersicum] Length = 502 Score = 51.6 bits (122), Expect(2) = 2e-06 Identities = 34/74 (45%), Positives = 42/74 (56%), Gaps = 13/74 (17%) Frame = +1 Query: 271 SHSKSLIARQNNLQSPPLSTPVIVPEE-----REQKFKEKFDAEEMP--------KEKTG 411 S SKS A +N LQSP LSTP + E R+QK +EKF+A+E KEK G Sbjct: 371 SVSKSFTAYRNKLQSPTLSTPFSLRTEERAARRKQKLEEKFNAKEEKKVQQQTTLKEKAG 430 Query: 412 RKFRKEHRIFCFKA 453 + RK + FCFKA Sbjct: 431 TELRKLGQSFCFKA 444 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 452 PDIYKEREA*KHQMKKSPVAQPQSAY*EEPIEARHMAPY 568 PD YKE E K KK PV Q P+ R PY Sbjct: 448 PDFYKETETAKDHAKKIPVTQ-------APLPKRGRMPY 479