BLASTX nr result
ID: Forsythia22_contig00013101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013101 (574 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071605.1| PREDICTED: hypersensitive-induced response p... 103 4e-20 ref|XP_010256438.1| PREDICTED: hypersensitive-induced response p... 102 2e-19 gb|KJB70936.1| hypothetical protein B456_011G096600 [Gossypium r... 101 2e-19 gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium r... 101 2e-19 gb|KJB70934.1| hypothetical protein B456_011G096600 [Gossypium r... 101 2e-19 ref|XP_012456393.1| PREDICTED: hypersensitive-induced response p... 101 2e-19 gb|ABS01349.1| hypersensitive-induced response protein [Carica p... 101 2e-19 ref|XP_010100924.1| Hypersensitive-induced response protein 1 [M... 101 3e-19 ref|XP_007037221.1| SPFH/Band 7/PHB domain-containing membrane-a... 101 3e-19 ref|XP_007037220.1| SPFH/Band 7/PHB domain-containing membrane-a... 101 3e-19 ref|XP_007032448.1| SPFH/Band 7/PHB domain-containing membrane-a... 101 3e-19 ref|XP_010086580.1| Hypersensitive-induced response protein 1 [M... 100 4e-19 ref|XP_012839408.1| PREDICTED: hypersensitive-induced response p... 100 4e-19 ref|XP_012080206.1| PREDICTED: hypersensitive-induced response p... 100 4e-19 gb|EYU35885.1| hypothetical protein MIMGU_mgv1a0125941mg, partia... 100 4e-19 ref|XP_012469789.1| PREDICTED: hypersensitive-induced response p... 100 6e-19 ref|XP_010028981.1| PREDICTED: hypersensitive-induced response p... 99 1e-18 ref|XP_009801981.1| PREDICTED: hypersensitive-induced response p... 98 2e-18 ref|XP_009614189.1| PREDICTED: hypersensitive-induced response p... 98 2e-18 ref|XP_006367072.1| PREDICTED: hypersensitive-induced response p... 98 2e-18 >ref|XP_011071605.1| PREDICTED: hypersensitive-induced response protein 1 [Sesamum indicum] Length = 287 Score = 103 bits (258), Expect = 4e-20 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_010256438.1| PREDICTED: hypersensitive-induced response protein 1 [Nelumbo nucifera] gi|719965433|ref|XP_010256447.1| PREDICTED: hypersensitive-induced response protein 1 [Nelumbo nucifera] Length = 286 Score = 102 bits (253), Expect = 2e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CC+QVDQSTVAIKE FGKF+EVLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGKFEEVLEPGCHCLPWFLGSQLAGHLSL 49 >gb|KJB70936.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 234 Score = 101 bits (252), Expect = 2e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVLEPGCHCLPW +GSQLAGHLTL Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWCIGSQLAGHLTL 49 >gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 274 Score = 101 bits (252), Expect = 2e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVLEPGCHCLPW +GSQLAGHLTL Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWCIGSQLAGHLTL 49 >gb|KJB70934.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 278 Score = 101 bits (252), Expect = 2e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVLEPGCHCLPW +GSQLAGHLTL Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWCIGSQLAGHLTL 49 >ref|XP_012456393.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium raimondii] gi|763803995|gb|KJB70933.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 286 Score = 101 bits (252), Expect = 2e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVLEPGCHCLPW +GSQLAGHLTL Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGCHCLPWCIGSQLAGHLTL 49 >gb|ABS01349.1| hypersensitive-induced response protein [Carica papaya] Length = 285 Score = 101 bits (252), Expect = 2e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAI+E FGKFD+VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIRERFGKFDDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_010100924.1| Hypersensitive-induced response protein 1 [Morus notabilis] gi|587897765|gb|EXB86236.1| Hypersensitive-induced response protein 1 [Morus notabilis] Length = 286 Score = 101 bits (251), Expect = 3e-19 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNLLCCVQVDQSTVAIKE FGKF+EVLEPGCHCLPWFLGS+L+GHL+L Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFEEVLEPGCHCLPWFLGSRLSGHLSL 49 >ref|XP_007037221.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 2 [Theobroma cacao] gi|508774466|gb|EOY21722.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 2 [Theobroma cacao] Length = 221 Score = 101 bits (251), Expect = 3e-19 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CC+QVDQSTVAIKE FG+FD+VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGRFDDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_007037220.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] gi|508774465|gb|EOY21721.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] Length = 284 Score = 101 bits (251), Expect = 3e-19 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CC+QVDQSTVAIKE FG+FD+VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGRFDDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_007032448.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] gi|590649627|ref|XP_007032449.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] gi|508711477|gb|EOY03374.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] gi|508711478|gb|EOY03375.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] Length = 286 Score = 101 bits (251), Expect = 3e-19 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFDEVL+PGCHCLPW LGSQLAGHLTL Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLQPGCHCLPWCLGSQLAGHLTL 49 >ref|XP_010086580.1| Hypersensitive-induced response protein 1 [Morus notabilis] gi|587829818|gb|EXB20735.1| Hypersensitive-induced response protein 1 [Morus notabilis] Length = 286 Score = 100 bits (250), Expect = 4e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNLLCCVQVDQSTVAIKE FGKF+EVLEPGCHCLPWFLG QL+GHL+L Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFEEVLEPGCHCLPWFLGCQLSGHLSL 49 >ref|XP_012839408.1| PREDICTED: hypersensitive-induced response protein 1 [Erythranthe guttatus] Length = 274 Score = 100 bits (250), Expect = 4e-19 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CC+QVDQSTVAIKE FGKF++VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGKFEDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_012080206.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|802652830|ref|XP_012080207.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|802652834|ref|XP_012080208.1| PREDICTED: hypersensitive-induced response protein 1 [Jatropha curcas] gi|643720943|gb|KDP31207.1| hypothetical protein JCGZ_11583 [Jatropha curcas] Length = 285 Score = 100 bits (250), Expect = 4e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNLLCCVQVDQSTVAI+E FGKFDEVL+PGCHCLPW LGSQLAGHL+L Sbjct: 1 MGNLLCCVQVDQSTVAIRERFGKFDEVLDPGCHCLPWILGSQLAGHLSL 49 >gb|EYU35885.1| hypothetical protein MIMGU_mgv1a0125941mg, partial [Erythranthe guttata] Length = 65 Score = 100 bits (250), Expect = 4e-19 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CC+QVDQSTVAIKE FGKF++VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGKFEDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_012469789.1| PREDICTED: hypersensitive-induced response protein 1 [Gossypium raimondii] gi|823122180|ref|XP_012469793.1| PREDICTED: hypersensitive-induced response protein 1 [Gossypium raimondii] gi|823122182|ref|XP_012469797.1| PREDICTED: hypersensitive-induced response protein 1 [Gossypium raimondii] gi|763740743|gb|KJB08242.1| hypothetical protein B456_001G073500 [Gossypium raimondii] gi|763740744|gb|KJB08243.1| hypothetical protein B456_001G073500 [Gossypium raimondii] Length = 284 Score = 100 bits (248), Expect = 6e-19 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FG+F++VLEPGCHCLPWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGRFEDVLEPGCHCLPWFLGSQLAGHLSL 49 >ref|XP_010028981.1| PREDICTED: hypersensitive-induced response protein 1-like [Eucalyptus grandis] gi|702257592|ref|XP_010028989.1| PREDICTED: hypersensitive-induced response protein 1-like [Eucalyptus grandis] gi|702257598|ref|XP_010028997.1| PREDICTED: hypersensitive-induced response protein 1-like [Eucalyptus grandis] gi|702257605|ref|XP_010029005.1| PREDICTED: hypersensitive-induced response protein 1-like [Eucalyptus grandis] gi|629119036|gb|KCW83526.1| hypothetical protein EUGRSUZ_B00429 [Eucalyptus grandis] Length = 285 Score = 99.4 bits (246), Expect = 1e-18 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGKFD+VL+PGCHCLPW LGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDDVLQPGCHCLPWILGSQLAGHLSL 49 >ref|XP_009801981.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana sylvestris] gi|698514153|ref|XP_009801982.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana sylvestris] gi|698514155|ref|XP_009801983.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana sylvestris] Length = 285 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGK+ +VLEPGCHC+PWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKEQFGKYQDVLEPGCHCVPWFLGSQLAGHLSL 49 >ref|XP_009614189.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana tomentosiformis] gi|697120444|ref|XP_009614190.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana tomentosiformis] gi|697120446|ref|XP_009614191.1| PREDICTED: hypersensitive-induced response protein 1 [Nicotiana tomentosiformis] Length = 283 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGK+ +VLEPGCHC+PWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKEQFGKYQDVLEPGCHCVPWFLGSQLAGHLSL 49 >ref|XP_006367072.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Solanum tuberosum] gi|565403245|ref|XP_006367073.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Solanum tuberosum] gi|565403247|ref|XP_006367074.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X3 [Solanum tuberosum] gi|409676316|gb|AFV33712.1| hypersensitive-induced reaction protein [Solanum tuberosum] Length = 285 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 427 MGNLLCCVQVDQSTVAIKEHFGKFDEVLEPGCHCLPWFLGSQLAGHLTL 573 MGNL CCVQVDQSTVAIKE FGK+ +VLEPGCHC+PWFLGSQLAGHL+L Sbjct: 1 MGNLFCCVQVDQSTVAIKEQFGKYQDVLEPGCHCVPWFLGSQLAGHLSL 49