BLASTX nr result
ID: Forsythia22_contig00013035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00013035 (613 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074251.1| PREDICTED: protein AUXIN-REGULATED GENE INVO... 61 4e-07 >ref|XP_011074251.1| PREDICTED: protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE [Sesamum indicum] Length = 134 Score = 61.2 bits (147), Expect = 4e-07 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 9/78 (11%) Frame = -3 Query: 575 MTAEQREAK-----GFMNLQDQYFNSIMDVKGGRNPTFLKRGGVVPLVEGR----KLEYC 423 MT +Q+ +K G+++LQDQ+ SIMD + ++ T +R V + EG+ +LE+C Sbjct: 1 MTVKQQRSKSALSKGYIDLQDQHLRSIMDGRMAKSATRQQRKSSVHMAEGQRLEHRLEHC 60 Query: 422 QSFSGGHGRKMFRYFTLE 369 +SFS GH KM RYFTLE Sbjct: 61 RSFSQGHSGKMSRYFTLE 78