BLASTX nr result
ID: Forsythia22_contig00012430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00012430 (809 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Erythra... 66 2e-08 ref|XP_002518932.1| conserved hypothetical protein [Ricinus comm... 62 6e-07 gb|KGN49971.1| hypothetical protein Csa_5G146940 [Cucumis sativus] 60 2e-06 ref|XP_008437456.1| PREDICTED: uncharacterized protein LOC103482... 58 8e-06 >gb|EYU35618.1| hypothetical protein MIMGU_mgv1a017467mg [Erythranthe guttata] Length = 73 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = -1 Query: 557 GGRDVTFNSSSHQGTSTNSLISSSEKNKFAPRFDGLRFIETLVTAHR 417 G RD++ NS ++QG S NS SSEK KFAP++DGL+FIETL+TAHR Sbjct: 27 GDRDISINSCTYQGKSVNSPPISSEKGKFAPKYDGLKFIETLITAHR 73 >ref|XP_002518932.1| conserved hypothetical protein [Ricinus communis] gi|223541919|gb|EEF43465.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 61.6 bits (148), Expect = 6e-07 Identities = 32/56 (57%), Positives = 39/56 (69%), Gaps = 9/56 (16%) Frame = -1 Query: 557 GGRDVTFNSSSHQGTST---------NSLISSSEKNKFAPRFDGLRFIETLVTAHR 417 G DV F+ SS+QG+S+ N+ SS+K KFAPRFDGLRFIETL+TAHR Sbjct: 22 GDSDVAFHPSSNQGSSSSVMGKLGASNACAPSSDKEKFAPRFDGLRFIETLITAHR 77 >gb|KGN49971.1| hypothetical protein Csa_5G146940 [Cucumis sativus] Length = 84 Score = 60.1 bits (144), Expect = 2e-06 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 7/54 (12%) Frame = -1 Query: 557 GGRDVTFNSSSHQGTSTNS-------LISSSEKNKFAPRFDGLRFIETLVTAHR 417 G RD+ S SHQG + S SSSEK KFAPRFDGLRFIETLVTAHR Sbjct: 31 GDRDLPLYSLSHQGFVSESGANRGCGADSSSEKEKFAPRFDGLRFIETLVTAHR 84 >ref|XP_008437456.1| PREDICTED: uncharacterized protein LOC103482871 [Cucumis melo] Length = 80 Score = 57.8 bits (138), Expect = 8e-06 Identities = 33/54 (61%), Positives = 34/54 (62%), Gaps = 7/54 (12%) Frame = -1 Query: 557 GGRDVTFNSSSHQGTSTNS-------LISSSEKNKFAPRFDGLRFIETLVTAHR 417 G RD+ SHQG S SSSEK KFAPRFDGLRFIETLVTAHR Sbjct: 27 GDRDLPLYPPSHQGFVPESGANRGCGADSSSEKEKFAPRFDGLRFIETLVTAHR 80