BLASTX nr result
ID: Forsythia22_contig00012060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00012060 (662 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 100 7e-19 ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase sub... 99 2e-18 ref|XP_012857474.1| PREDICTED: probable cytochrome c oxidase sub... 99 3e-18 ref|XP_012839568.1| PREDICTED: probable cytochrome c oxidase sub... 98 3e-18 ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 93 1e-16 gb|AFK48388.1| unknown [Lotus japonicus] 93 1e-16 ref|XP_010038288.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 92 2e-16 gb|KCW50112.1| hypothetical protein EUGRSUZ_K03546, partial [Euc... 92 2e-16 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 92 2e-16 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 92 2e-16 gb|ACU15919.1| unknown [Glycine max] 92 2e-16 ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutr... 92 3e-16 gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] 91 4e-16 gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncat... 91 4e-16 ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutr... 91 4e-16 ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago tr... 91 4e-16 emb|CDY27493.1| BnaC04g51340D [Brassica napus] 91 5e-16 ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase sub... 91 5e-16 ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 91 5e-16 ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 91 5e-16 >ref|XP_011070033.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] gi|747048079|ref|XP_011070034.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] gi|747048081|ref|XP_011070035.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Sesamum indicum] Length = 63 Score = 100 bits (249), Expect = 7e-19 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 P+VVKEI+IGI LG AAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE Sbjct: 13 PNVVKEIIIGITLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 63 >ref|XP_011079230.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Sesamum indicum] Length = 64 Score = 99.4 bits (246), Expect = 2e-18 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI IGIVLG AAGSVWKMHHWNEQRKVRAFYDLLDKGEI+VVAAE+ Sbjct: 14 PSVVKEIAIGIVLGIAAGSVWKMHHWNEQRKVRAFYDLLDKGEISVVAAEQ 64 >ref|XP_012857474.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|604301123|gb|EYU20843.1| hypothetical protein MIMGU_mgv1a017612mg [Erythranthe guttata] Length = 64 Score = 98.6 bits (244), Expect = 3e-18 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI+IGI LG AAGSVWKMHHWNEQRKVR+FYD+LDKGEITVVAAEE Sbjct: 14 PSVVKEILIGIALGFAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >ref|XP_012839568.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|848878286|ref|XP_012839569.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Erythranthe guttatus] gi|604330690|gb|EYU35673.1| hypothetical protein MIMGU_mgv1a017603mg [Erythranthe guttata] Length = 64 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKE++IGI LG AAGSVWKMHHWNEQRKVR+FYD+LDKGEITVVAAEE Sbjct: 14 PSVVKELLIGIALGVAAGSVWKMHHWNEQRKVRSFYDMLDKGEITVVAAEE 64 >ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Cicer arietinum] Length = 64 Score = 93.2 bits (230), Expect = 1e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI+IGI LG AAGSVWKMHHWNEQRK R FYDLL+KGEI+V+A EE Sbjct: 14 PSVVKEIIIGITLGIAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVIAEEE 64 >gb|AFK48388.1| unknown [Lotus japonicus] Length = 64 Score = 93.2 bits (230), Expect = 1e-16 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEIVIG+VLG AAGSVWKMHHWNEQRK R FYDLL+KGEI VVA EE Sbjct: 14 PSVVKEIVIGMVLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEIGVVAEEE 64 >ref|XP_010038288.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Eucalyptus grandis] Length = 63 Score = 92.4 bits (228), Expect = 2e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 513 PSVVKEI+IGI LG AAG VWKMHHWNEQRKVRAFYDLL+KGEI+VVA E Sbjct: 14 PSVVKEILIGITLGLAAGGVWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 63 >gb|KCW50112.1| hypothetical protein EUGRSUZ_K03546, partial [Eucalyptus grandis] Length = 93 Score = 92.4 bits (228), Expect = 2e-16 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAE 513 PSVVKEI+IGI LG AAG VWKMHHWNEQRKVRAFYDLL+KGEI+VVA E Sbjct: 44 PSVVKEILIGITLGLAAGGVWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 93 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 92.4 bits (228), Expect = 2e-16 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI+IGI LG AAG VWKMHHWNEQRK R FYDLL+KGEITVVA E+ Sbjct: 14 PSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] gi|734338021|gb|KHN08636.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] Length = 64 Score = 92.4 bits (228), Expect = 2e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI+IGI LG AAGSVWKMHHWNEQRK R FYDLL+KGEI+VVA E+ Sbjct: 14 PSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|ACU15919.1| unknown [Glycine max] Length = 64 Score = 92.4 bits (228), Expect = 2e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI+IGI LG AAGSVWKMHHWNEQRK R FYDLL+KGEI+VVA E+ Sbjct: 14 PSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] gi|557103478|gb|ESQ43832.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] Length = 64 Score = 91.7 bits (226), Expect = 3e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKE++IG+ LG AAG +WKMHHWNEQRK RAFYDLL++GEI+VVAAEE Sbjct: 14 PSVVKELIIGLTLGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVVAAEE 64 >gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] Length = 64 Score = 91.3 bits (225), Expect = 4e-16 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVK+I+IGI LG AAG VWKMHHWNEQRK R FYDLL+KGEITVVA E+ Sbjct: 14 PSVVKDIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncatula] Length = 117 Score = 91.3 bits (225), Expect = 4e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI IGIVLG AAGSVWKMHHWNEQRK R F+DLL+KGEI+V+A EE Sbjct: 67 PSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEEE 117 >ref|XP_006397931.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|567166811|ref|XP_006397932.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|567166814|ref|XP_006397933.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099004|gb|ESQ39384.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099005|gb|ESQ39385.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] gi|557099006|gb|ESQ39386.1| hypothetical protein EUTSA_v10001714mg [Eutrema salsugineum] Length = 64 Score = 91.3 bits (225), Expect = 4e-16 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKE++IG+ LG AAG +WKMHHWNEQRK RAFYDLL++GEI+VVAAEE Sbjct: 14 PSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVVAAEE 64 >ref|XP_003625971.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|388519391|gb|AFK47757.1| unknown [Medicago truncatula] Length = 64 Score = 91.3 bits (225), Expect = 4e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI IGIVLG AAGSVWKMHHWNEQRK R F+DLL+KGEI+V+A EE Sbjct: 14 PSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEEE 64 >emb|CDY27493.1| BnaC04g51340D [Brassica napus] Length = 116 Score = 90.9 bits (224), Expect = 5e-16 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKE++IG+ LG AAG +WKMHHWNEQRK RAFYDLL++GEI V+AAEE Sbjct: 66 PSVVKELIIGLALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEINVIAAEE 116 >ref|XP_009133811.1| PREDICTED: probable cytochrome c oxidase subunit 5C-1 [Brassica rapa] gi|674895068|emb|CDY37800.1| BnaC04g00250D [Brassica napus] gi|674937787|emb|CDX95722.1| BnaC03g26030D [Brassica napus] gi|674950141|emb|CDX83330.1| BnaA03g21760D [Brassica napus] Length = 64 Score = 90.9 bits (224), Expect = 5e-16 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKE++IG+ LG AAG +WKMHHWNEQRK RAFYDLL++GEI+V+AAEE Sbjct: 14 PSVVKELIIGMALGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVIAAEE 64 >ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X3 [Glycine max] Length = 68 Score = 90.9 bits (224), Expect = 5e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI IG+VLG AAGSVWKMHHWNEQRK RAFYDLL+K EI+VVA EE Sbjct: 18 PSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 68 >ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Glycine max] Length = 95 Score = 90.9 bits (224), Expect = 5e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -1 Query: 662 PSVVKEIVIGIVLGCAAGSVWKMHHWNEQRKVRAFYDLLDKGEITVVAAEE 510 PSVVKEI IG+VLG AAGSVWKMHHWNEQRK RAFYDLL+K EI+VVA EE Sbjct: 45 PSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 95