BLASTX nr result
ID: Forsythia22_contig00009214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00009214 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43582.1| hypothetical protein MIMGU_mgv1a017488mg [Erythra... 58 2e-06 gb|EPS72107.1| hypothetical protein M569_02654 [Genlisea aurea] 57 4e-06 >gb|EYU43582.1| hypothetical protein MIMGU_mgv1a017488mg [Erythranthe guttata] Length = 71 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 6/68 (8%) Frame = -3 Query: 231 MTTAGAALAEIYVKKKLHKEKTKGMENKGSKGKSLTYNQG------KSDSGSGCFSFILF 70 M+TA A LAE Y+ +K++KEK M+N K + ++ + +S SG GCFS +F Sbjct: 1 MSTASAGLAEAYMIRKVYKEKMNKMDNVSEKPMNSSHEKAEEKSCRRSASGGGCFSLSMF 60 Query: 69 KKVHPNAV 46 KK+HPN + Sbjct: 61 KKIHPNTI 68 >gb|EPS72107.1| hypothetical protein M569_02654 [Genlisea aurea] Length = 79 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/61 (47%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = -3 Query: 231 MTTAGAALAEIYVKKKLHKEKTKGMENKGSKGKSLTYNQGKSDSGSGCFSFI--LFKKVH 58 M+++ A AE+Y KK++KEKT+ +E++ S+G S N K SGSGCFS + FKK+H Sbjct: 15 MSSSAAGFAEVYAMKKIYKEKTERIEDRKSRGSS--ENGSKKKSGSGCFSGVPFSFKKIH 72 Query: 57 P 55 P Sbjct: 73 P 73