BLASTX nr result
ID: Forsythia22_contig00009208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00009208 (2217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Go... 81 3e-12 >gb|KJB09734.1| hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 81.3 bits (199), Expect = 3e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -2 Query: 1304 LSRNFAHPFHFCAGGNGIRTHDTIFLYVDLANQCLKPLSHTSKL 1173 LSRNFA P F AGGNGIRTHDTIFLYVDLANQCLKPLSH SKL Sbjct: 197 LSRNFACPLDFRAGGNGIRTHDTIFLYVDLANQCLKPLSHPSKL 240