BLASTX nr result
ID: Forsythia22_contig00009162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00009162 (845 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010324777.1| PREDICTED: geranyl pyrophosphate synthase is... 60 1e-06 >ref|XP_010324777.1| PREDICTED: geranyl pyrophosphate synthase isoform X1 [Solanum lycopersicum] Length = 431 Score = 60.5 bits (145), Expect = 1e-06 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 1 SNSCKAIALLAGQTAEVSMMAFEYGKNLVRVLFQCTSDMALPLQ 132 SNSCKAIALLAG +AEVS++AF+YGKNLV ++F C S + L +Q Sbjct: 266 SNSCKAIALLAGHSAEVSVLAFDYGKNLVCIIFCCESYLILFMQ 309