BLASTX nr result
ID: Forsythia22_contig00007095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00007095 (209 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009612745.1| PREDICTED: zinc finger HIT domain-containing... 110 5e-22 ref|XP_009793281.1| PREDICTED: zinc finger HIT domain-containing... 109 6e-22 ref|XP_009793280.1| PREDICTED: zinc finger HIT domain-containing... 109 6e-22 ref|XP_004245472.1| PREDICTED: zinc finger HIT domain-containing... 107 4e-21 ref|XP_006343799.1| PREDICTED: zinc finger HIT domain-containing... 105 1e-20 ref|XP_004297114.1| PREDICTED: zinc finger HIT domain-containing... 101 2e-19 ref|XP_011070368.1| PREDICTED: zinc finger HIT domain-containing... 100 6e-19 ref|XP_008374095.1| PREDICTED: zinc finger HIT domain-containing... 98 2e-18 ref|XP_008374094.1| PREDICTED: zinc finger HIT domain-containing... 98 2e-18 ref|XP_009358671.1| PREDICTED: zinc finger HIT domain-containing... 97 4e-18 ref|XP_009358670.1| PREDICTED: zinc finger HIT domain-containing... 97 4e-18 ref|XP_008239214.1| PREDICTED: zinc finger HIT domain-containing... 95 2e-17 ref|XP_010659870.1| PREDICTED: zinc finger HIT domain-containing... 94 3e-17 ref|XP_002518888.1| zinc finger protein, putative [Ricinus commu... 94 3e-17 ref|XP_002273095.1| PREDICTED: zinc finger HIT domain-containing... 94 3e-17 emb|CAN74601.1| hypothetical protein VITISV_028111 [Vitis vinifera] 94 3e-17 ref|XP_012086651.1| PREDICTED: zinc finger HIT domain-containing... 94 4e-17 ref|XP_007209196.1| hypothetical protein PRUPE_ppa006441mg [Prun... 94 5e-17 ref|XP_012851339.1| PREDICTED: zinc finger HIT domain-containing... 92 1e-16 gb|EYU25799.1| hypothetical protein MIMGU_mgv1a009842mg [Erythra... 92 1e-16 >ref|XP_009612745.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Nicotiana tomentosiformis] Length = 409 Score = 110 bits (274), Expect = 5e-22 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 I+ DDLS EERK FQRAVASGELSKLIKPW+PWWLKPSAK ISLGQDG LVQPLV +D+ Sbjct: 120 INFDDLSVEERKHFQRAVASGELSKLIKPWEPWWLKPSAKNISLGQDGTQLVQPLVREDT 179 Query: 28 VESSGNDME 2 SS +D+E Sbjct: 180 AVSSEDDIE 188 >ref|XP_009793281.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Nicotiana sylvestris] Length = 348 Score = 109 bits (273), Expect = 6e-22 Identities = 52/69 (75%), Positives = 61/69 (88%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 I+ DDLS+EERK FQRAVASGELSKLIKPW+PWWLKPSA+ ISLG+DGA LVQPLV +D+ Sbjct: 59 INFDDLSAEERKHFQRAVASGELSKLIKPWEPWWLKPSARNISLGRDGAQLVQPLVREDA 118 Query: 28 VESSGNDME 2 SS +D+E Sbjct: 119 ALSSEDDIE 127 >ref|XP_009793280.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Nicotiana sylvestris] Length = 409 Score = 109 bits (273), Expect = 6e-22 Identities = 52/69 (75%), Positives = 61/69 (88%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 I+ DDLS+EERK FQRAVASGELSKLIKPW+PWWLKPSA+ ISLG+DGA LVQPLV +D+ Sbjct: 120 INFDDLSAEERKHFQRAVASGELSKLIKPWEPWWLKPSARNISLGRDGAQLVQPLVREDA 179 Query: 28 VESSGNDME 2 SS +D+E Sbjct: 180 ALSSEDDIE 188 >ref|XP_004245472.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Solanum lycopersicum] Length = 409 Score = 107 bits (266), Expect = 4e-21 Identities = 50/64 (78%), Positives = 57/64 (89%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 IS +DLS+EE+K FQRAVASGELSKLIKPW+PWW KPSAKYISLGQDG LVQPLV++D+ Sbjct: 120 ISFEDLSAEEKKHFQRAVASGELSKLIKPWEPWWSKPSAKYISLGQDGTQLVQPLVKEDT 179 Query: 28 VESS 17 SS Sbjct: 180 AVSS 183 >ref|XP_006343799.1| PREDICTED: zinc finger HIT domain-containing protein 2-like [Solanum tuberosum] Length = 409 Score = 105 bits (262), Expect = 1e-20 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 IS +DLS+EE+K FQRAVASGELSKLIKPW+PWW KPSAKYISLGQDG LVQ LV++D+ Sbjct: 120 ISFEDLSAEEKKHFQRAVASGELSKLIKPWEPWWSKPSAKYISLGQDGTQLVQSLVKEDT 179 Query: 28 VESSGNDME 2 SS + +E Sbjct: 180 AVSSEDGIE 188 >ref|XP_004297114.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Fragaria vesca subsp. vesca] Length = 415 Score = 101 bits (251), Expect = 2e-19 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +SLDDL +EE+K FQRAVASGELSK+IKPWDPWWLKPSA+ IS ++G L+QPL +D Sbjct: 124 VSLDDLPAEEKKLFQRAVASGELSKMIKPWDPWWLKPSARTISFSKEGTQLIQPLAREDE 183 Query: 28 VESSGNDME 2 SS +D+E Sbjct: 184 PMSSEDDLE 192 >ref|XP_011070368.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] gi|747048701|ref|XP_011070369.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] Length = 412 Score = 99.8 bits (247), Expect = 6e-19 Identities = 48/69 (69%), Positives = 55/69 (79%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 IS DDLS EE+K FQRAVA+GELSKLI+PWDPWW KPSAK ISLG DG LV+P+ E+ Sbjct: 122 ISFDDLSVEEKKRFQRAVATGELSKLIEPWDPWWFKPSAKNISLGSDGIQLVRPIEEEGL 181 Query: 28 VESSGNDME 2 SS ND+E Sbjct: 182 GPSSENDVE 190 >ref|XP_008374095.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Malus domestica] Length = 414 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +SLDDLS+EE+K FQRAV SGELSK+IKPWDPWWLKPSA+ IS ++G+ L+QPLV+ D Sbjct: 124 VSLDDLSTEEKKLFQRAVVSGELSKMIKPWDPWWLKPSARTISFSKEGSQLIQPLVKDDE 183 Query: 28 VESSGNDME 2 S ++ E Sbjct: 184 SMSPEDNSE 192 >ref|XP_008374094.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Malus domestica] Length = 415 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/69 (63%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +SLDDLS+EE+K FQRAV SGELSK+IKPWDPWWLKPSA+ IS ++G+ L+QPLV+ D Sbjct: 125 VSLDDLSTEEKKLFQRAVVSGELSKMIKPWDPWWLKPSARTISFSKEGSQLIQPLVKDDE 184 Query: 28 VESSGNDME 2 S ++ E Sbjct: 185 SMSPEDNSE 193 >ref|XP_009358671.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Pyrus x bretschneideri] Length = 414 Score = 97.1 bits (240), Expect = 4e-18 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +SLDDLS EE+K FQRAV SGELSK+IKPWDPWWLKPSA+ IS ++G+ L+QPLV+ D Sbjct: 124 VSLDDLSIEEKKLFQRAVVSGELSKMIKPWDPWWLKPSARTISFSKEGSQLIQPLVKDDE 183 Query: 28 VESSGNDME 2 S ++ E Sbjct: 184 SMSPEDNSE 192 >ref|XP_009358670.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Pyrus x bretschneideri] Length = 415 Score = 97.1 bits (240), Expect = 4e-18 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +SLDDLS EE+K FQRAV SGELSK+IKPWDPWWLKPSA+ IS ++G+ L+QPLV+ D Sbjct: 125 VSLDDLSIEEKKLFQRAVVSGELSKMIKPWDPWWLKPSARTISFSKEGSQLIQPLVKDDE 184 Query: 28 VESSGNDME 2 S ++ E Sbjct: 185 SMSPEDNSE 193 >ref|XP_008239214.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Prunus mume] Length = 412 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/69 (57%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S DDLS+EE+K FQ+AVASGELSK+IKPWDPWWLKPSA+ I+ ++G L++PL ++ Sbjct: 122 VSFDDLSAEEKKLFQKAVASGELSKMIKPWDPWWLKPSARTITFSKEGTQLIKPLANEEE 181 Query: 28 VESSGNDME 2 S+ +D+E Sbjct: 182 SMSTEDDLE 190 >ref|XP_010659870.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Vitis vinifera] Length = 363 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S DDLS E++ FQRAVASGELSK+I+PW PWWLKP+A+ +SL Q+G LVQPL++Q++ Sbjct: 74 VSFDDLSPNEKRLFQRAVASGELSKMIEPWVPWWLKPAARTLSLSQEGTQLVQPLIKQET 133 Query: 28 VESSGNDME 2 SS +D E Sbjct: 134 SVSSEDDPE 142 >ref|XP_002518888.1| zinc finger protein, putative [Ricinus communis] gi|223541875|gb|EEF43421.1| zinc finger protein, putative [Ricinus communis] Length = 411 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/67 (65%), Positives = 57/67 (85%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S +DLS+EE+ FQRAVASG+LSKLI+PW+PWWLKPSA+ ISL ++G LVQPLVEQ++ Sbjct: 122 MSFEDLSAEEKIQFQRAVASGKLSKLIQPWNPWWLKPSARTISLSKEGTQLVQPLVEQEA 181 Query: 28 VESSGND 8 SS +D Sbjct: 182 SASSQDD 188 >ref|XP_002273095.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Vitis vinifera] gi|297742416|emb|CBI34565.3| unnamed protein product [Vitis vinifera] Length = 409 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S DDLS E++ FQRAVASGELSK+I+PW PWWLKP+A+ +SL Q+G LVQPL++Q++ Sbjct: 120 VSFDDLSPNEKRLFQRAVASGELSKMIEPWVPWWLKPAARTLSLSQEGTQLVQPLIKQET 179 Query: 28 VESSGNDME 2 SS +D E Sbjct: 180 SVSSEDDPE 188 >emb|CAN74601.1| hypothetical protein VITISV_028111 [Vitis vinifera] Length = 843 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S DDLS E++ FQRAVASGELSK+I+PW PWWLKP+A+ +SL Q+G LVQPL++Q++ Sbjct: 554 VSFDDLSPNEKRLFQRAVASGELSKMIEPWVPWWLKPAARTLSLSQEGTQLVQPLIKQET 613 Query: 28 VESSGNDME 2 SS +D E Sbjct: 614 SVSSEDDPE 622 >ref|XP_012086651.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Jatropha curcas] gi|643711809|gb|KDP25237.1| hypothetical protein JCGZ_20393 [Jatropha curcas] Length = 405 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/69 (63%), Positives = 57/69 (82%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 IS DDLS EE+K FQRA+ASGELSKLI+PW+PWWLKPSA+ ISL ++G L++PLVEQ++ Sbjct: 122 ISFDDLSVEEKKQFQRALASGELSKLIEPWEPWWLKPSARKISLSKEGTLLIRPLVEQEA 181 Query: 28 VESSGNDME 2 + +D E Sbjct: 182 SLAPQDDGE 190 >ref|XP_007209196.1| hypothetical protein PRUPE_ppa006441mg [Prunus persica] gi|462404931|gb|EMJ10395.1| hypothetical protein PRUPE_ppa006441mg [Prunus persica] Length = 412 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/69 (56%), Positives = 55/69 (79%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 +S DDLS+EE+K FQ+AV SGELSK+IKPWDPWWLKPSA+ I+ ++G L++PL ++ Sbjct: 122 VSFDDLSAEEKKLFQKAVVSGELSKMIKPWDPWWLKPSARAITFSKEGTQLIKPLANEEE 181 Query: 28 VESSGNDME 2 S+ +D+E Sbjct: 182 SMSTEDDLE 190 >ref|XP_012851339.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Erythranthe guttatus] Length = 411 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/66 (63%), Positives = 53/66 (80%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 ++ DDLS+EE+K FQRA+ SGELSKLI+PWDPWWLKPSAK ISL DG +Q +V++ S Sbjct: 122 LNFDDLSTEEKKHFQRAIISGELSKLIEPWDPWWLKPSAKNISLTSDGTQRIQRIVKEYS 181 Query: 28 VESSGN 11 VES + Sbjct: 182 VESEND 187 >gb|EYU25799.1| hypothetical protein MIMGU_mgv1a009842mg [Erythranthe guttata] Length = 329 Score = 92.0 bits (227), Expect = 1e-16 Identities = 42/66 (63%), Positives = 53/66 (80%) Frame = -2 Query: 208 ISLDDLSSEERKCFQRAVASGELSKLIKPWDPWWLKPSAKYISLGQDGASLVQPLVEQDS 29 ++ DDLS+EE+K FQRA+ SGELSKLI+PWDPWWLKPSAK ISL DG +Q +V++ S Sbjct: 40 LNFDDLSTEEKKHFQRAIISGELSKLIEPWDPWWLKPSAKNISLTSDGTQRIQRIVKEYS 99 Query: 28 VESSGN 11 VES + Sbjct: 100 VESEND 105