BLASTX nr result
ID: Forsythia22_contig00005477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00005477 (432 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10991.1| unnamed protein product [Coffea canephora] 44 2e-06 >emb|CDP10991.1| unnamed protein product [Coffea canephora] Length = 477 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +2 Query: 275 LCVQERKCMAVIEERCVQELASRPS-PEDNFEKEA 376 + V ERK MAV+EER +QEL RP+ PEDNFEK+A Sbjct: 290 MAVLERKRMAVLEERRLQELTVRPTPPEDNFEKKA 324 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 376 LNAMGATEEGDFVFGSNDE 432 + AMGA EEGD VFGSNDE Sbjct: 325 MKAMGAMEEGDAVFGSNDE 343