BLASTX nr result
ID: Forsythia22_contig00005310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00005310 (465 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas p... 85 2e-14 ref|XP_012084959.1| PREDICTED: metallothionein-like protein type... 84 4e-14 gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus g... 82 1e-13 emb|CAB85630.1| putative metallothionein-like protein [Vitis vin... 78 2e-12 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 77 4e-12 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 75 2e-11 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 75 2e-11 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 74 5e-11 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 73 6e-11 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 72 1e-10 sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein... 71 3e-10 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 71 3e-10 ref|XP_009356815.1| PREDICTED: metallothionein-like protein type... 70 4e-10 gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneid... 70 4e-10 gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb... 70 5e-10 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 70 5e-10 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 70 7e-10 emb|CDP05918.1| unnamed protein product [Coffea canephora] 69 9e-10 gb|AGL34968.1| metallothionein type 3 [Coffea arabica] 69 9e-10 ref|XP_007212343.1| hypothetical protein PRUPE_ppa014506mg [Prun... 69 9e-10 >ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas pseudoalcaligenes] gi|782990300|gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAA 269 MS CGNCDC D+SQCVKKGS+YGIDIVET KSY+ET+VMDAPAA Sbjct: 22 MSSTCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAA 66 >ref|XP_012084959.1| PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] gi|282848222|gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] gi|643714554|gb|KDP27057.1| hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS CGNCDC D+SQCVKKGS+Y DIVETEKS++ T+VMD PA AEND Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus grandis] Length = 69 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS KCGNCDC DQSQC KKGS+Y D VETEKS+IETV MDAP AAEND Sbjct: 1 MSDKCGNCDCADQSQCTKKGSSYAADFVETEKSHIETVFMDAP-AAEND 48 >emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 Query: 391 CGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAA 269 CGNCDC D+SQCVKKG++YGIDIVETEKSY+ TVVM+ PAA Sbjct: 4 CGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAA 44 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAA 269 MS CGNCDC D+SQCVKKGS+Y DIVETEKS++ T++MD PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAA 45 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = -3 Query: 391 CGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 CGNCDC D+SQCVKKG++YGI+I+ETEKSY++ VV +APAAA+N+ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVV-EAPAAAKNE 47 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPA 272 MS CGNCDC D+SQCVKKGS+Y DIVETEKS++ TVVM+ PA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPA 44 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAA 269 MS CGNCDC D+SQCVKKGS+Y D+VETEKS + T+VM+ PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAA 45 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 [Carica papaya] gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 73.2 bits (178), Expect = 6e-11 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS CGNCDC D++QCVKKGS+Y DI+ETEKS I TVVMDAP AAEND Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKS-IMTVVMDAP-AAEND 47 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -3 Query: 391 CGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 CGNCDC D+SQCVKKG++YGIDIVETEKSY++ V++ A AAE+D Sbjct: 4 CGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIV-AAEAAEHD 47 >sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein type 3 [Actinidia deliciosa] gi|1086020|pir||S48037 metallothionein-like protein - kiwi fruit gi|450241|gb|AAA53072.1| metallothionein-like protein [Actinidia deliciosa] Length = 63 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAA 269 MS KCGNCDC D SQCVKKG++ IDIVET+KSYIE VVM PAA Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIEDVVMGVPAA 43 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 391 CGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 CGNCDC D+SQCVKKG++YGI+I+ETEKS V+ DAPAAAE++ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI-DAPAAAEHE 47 >ref|XP_009356815.1| PREDICTED: metallothionein-like protein type 3 [Pyrus x bretschneideri] Length = 91 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MSGKC NCDC D SQC KKG +Y + IVETE ++TVV+DAP AAEND Sbjct: 26 MSGKCDNCDCADSSQCTKKGKSYDLVIVETENRSMDTVVVDAP-AAEND 73 >gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneideri] Length = 66 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MSGKC NCDC D SQC KKG +Y + IVETE ++TVV+DAP AAEND Sbjct: 1 MSGKCDNCDCADSSQCTKKGKSYDLVIVETENRSMDTVVVDAP-AAEND 48 >gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb|ABV58318.1| metallothionein type 3 [Oryza coarctata] Length = 64 Score = 70.1 bits (170), Expect = 5e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS KCGNCDC D+SQCVKKG++YG+ +V+TEKS++E + A A AEND Sbjct: 1 MSDKCGNCDCADKSQCVKKGNSYGVVLVDTEKSHLEEI---AAAGAEND 46 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS CGNCDC D++QCVK G+ YG+DIVETEK +ETVVM+ P A END Sbjct: 1 MSNTCGNCDCADKTQCVK-GNKYGVDIVETEKRMVETVVMEVP-AGEND 47 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS C NCDC D++QCVKKGS+Y DIVETEKS++ T VM+ P A END Sbjct: 1 MSSTCDNCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVP-ATEND 48 >emb|CDP05918.1| unnamed protein product [Coffea canephora] Length = 65 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVM 284 MS KCGNCDC D+SQCVKKGS+Y DIVETE +++ET VM Sbjct: 1 MSDKCGNCDCADKSQCVKKGSSYAADIVETENTFVETFVM 40 >gb|AGL34968.1| metallothionein type 3 [Coffea arabica] Length = 65 Score = 69.3 bits (168), Expect = 9e-10 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVM 284 MS KCGNCDC D+SQCVKKGS+Y DIVETE +++ET VM Sbjct: 1 MSDKCGNCDCADRSQCVKKGSSYAADIVETENTFVETFVM 40 >ref|XP_007212343.1| hypothetical protein PRUPE_ppa014506mg [Prunus persica] gi|462408208|gb|EMJ13542.1| hypothetical protein PRUPE_ppa014506mg [Prunus persica] Length = 66 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 403 MSGKCGNCDCTDQSQCVKKGSAYGIDIVETEKSYIETVVMDAPAAAEND 257 MS KC +C+CTD SQC KKGS+Y + IVETE ++TV+MDAP AAEND Sbjct: 1 MSSKCSDCNCTDSSQCTKKGSSYDLVIVETENRSMDTVIMDAP-AAEND 48