BLASTX nr result
ID: Forsythia22_contig00004452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00004452 (375 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158... 60 6e-07 >ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum] Length = 421 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = -3 Query: 181 PNRFFRYGATRPDFPCFGSKSLISTPLVQRPQSISRVKLGKRKVNFVNRKCTSIRASMQ 5 PN R G RP+ GS+SL+S +++ SIS VKLG RKV+FV RKCT IRASMQ Sbjct: 16 PNWVARSGPARPELRV-GSRSLLSYSWIRQRPSISHVKLGNRKVDFVTRKCTGIRASMQ 73