BLASTX nr result
ID: Forsythia22_contig00004288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00004288 (471 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077684.1| PREDICTED: mitochondrial import receptor sub... 92 1e-16 ref|XP_011077105.1| PREDICTED: mitochondrial import receptor sub... 92 1e-16 ref|XP_012850170.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_006360661.1| PREDICTED: mitochondrial import receptor sub... 90 5e-16 ref|XP_004242882.1| PREDICTED: mitochondrial import receptor sub... 90 5e-16 ref|XP_009628067.1| PREDICTED: mitochondrial import receptor sub... 90 7e-16 sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 90 7e-16 ref|XP_009768665.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 ref|XP_004240126.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 ref|XP_008391413.1| PREDICTED: mitochondrial import receptor sub... 88 3e-15 gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] 87 4e-15 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 87 4e-15 ref|XP_010046892.1| PREDICTED: mitochondrial import receptor sub... 87 6e-15 ref|XP_009362070.1| PREDICTED: mitochondrial import receptor sub... 87 6e-15 ref|XP_009344055.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_008341149.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 86 7e-15 ref|XP_010915807.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_008455820.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 >ref|XP_011077684.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/78 (58%), Positives = 52/78 (66%) Frame = +3 Query: 147 MASKISLXXXXXXXXXXXXXXXXXXXXXXXXXKFVKDWSTWAVKKAKVVTHYGFIPLVII 326 MASK+SL KFVK+WSTW +KKAKV+THYGFIP+VII Sbjct: 1 MASKVSLKAGKGKVVKKSAAADEEEGSMAVAAKFVKEWSTWTMKKAKVITHYGFIPMVII 60 Query: 327 IGMNSEPKPSISQLLSPV 380 IGMNSEPKPS+SQLLSPV Sbjct: 61 IGMNSEPKPSLSQLLSPV 78 >ref|XP_011077105.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/78 (58%), Positives = 52/78 (66%) Frame = +3 Query: 147 MASKISLXXXXXXXXXXXXXXXXXXXXXXXXXKFVKDWSTWAVKKAKVVTHYGFIPLVII 326 MASK+SL KFVK+WSTW +KKAKV+THYGFIP+VII Sbjct: 1 MASKVSLKAGKGKVVKKSAAADEEEGSMVVAAKFVKEWSTWTMKKAKVITHYGFIPMVII 60 Query: 327 IGMNSEPKPSISQLLSPV 380 IGMNSEPKPS+SQLLSPV Sbjct: 61 IGMNSEPKPSLSQLLSPV 78 >ref|XP_012850170.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Erythranthe guttatus] gi|604313221|gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Erythranthe guttata] Length = 78 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 KFVK+WSTW +KKAKV+THYGFIPLVIIIGMNS+PKPS+SQLLSPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >ref|XP_006360661.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum tuberosum] Length = 78 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +3 Query: 246 FVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 FVKDWSTW KKAKV+THYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 34 FVKDWSTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_004242882.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Solanum lycopersicum] Length = 77 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 KFVK+W TW+ KKAKV+THYGFIPLVIIIGMNSEPKPS+SQLLSPV Sbjct: 32 KFVKEWGTWSAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >ref|XP_009628067.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana tomentosiformis] gi|698434433|ref|XP_009798962.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Nicotiana sylvestris] Length = 77 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 KFVK+W TW KKAKV+THYGFIPLVIIIGMNSEPKPS+SQLLSPV Sbjct: 32 KFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 77 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 KFVK+W TW KKAKV+THYGFIPLVIIIGMNSEPKPS+SQLLSPV Sbjct: 27 KFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 >ref|XP_009768665.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nicotiana sylvestris] Length = 77 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 KFVK+W TW KKAKV+THYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 32 KFVKEWGTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 77 >ref|XP_004240126.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Solanum lycopersicum] Length = 78 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +3 Query: 246 FVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 FVKDW+TW KKAKV+THYGFIPLVII+GMNSEPKPS+SQLLSPV Sbjct: 34 FVKDWTTWTAKKAKVITHYGFIPLVIILGMNSEPKPSLSQLLSPV 78 >ref|XP_008391413.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 +FVK+WSTW +KKAKVVTHYGFIPLVIIIGMNS+PKP +SQLLSPV Sbjct: 28 QFVKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >gb|EPS63209.1| hypothetical protein M569_11578 [Genlisea aurea] Length = 81 Score = 87.0 bits (214), Expect = 4e-15 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 K VK WS W +KKAKV+THYGFIPL+IIIGMNSEPKPSISQLLSPV Sbjct: 36 KLVKQWSNWGLKKAKVITHYGFIPLIIIIGMNSEPKPSISQLLSPV 81 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|645234757|ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 249 VKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 VK+WSTWA+KKAKVVTHYGFIPL+I+IGMNSEPKP +SQLLSPV Sbjct: 30 VKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_010046892.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Eucalyptus grandis] Length = 84 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +3 Query: 249 VKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 +K+WSTWA+KKAKV+THYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 41 IKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHLSQLLSPV 84 >ref|XP_009362070.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 249 VKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 VK+WSTWA+KKAKVVTHYGFIPLVIIIGMNS+PKP +SQLLSPV Sbjct: 30 VKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_009344055.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 86.3 bits (212), Expect = 7e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +3 Query: 252 KDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 K+WSTWA+KKAKVVTHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 31 KEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_008341149.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Malus domestica] gi|694409870|ref|XP_009379554.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 86.3 bits (212), Expect = 7e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +3 Query: 252 KDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 K+WSTWA+KKAKVVTHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 31 KEWSTWALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Cucumis sativus] gi|700208174|gb|KGN63293.1| hypothetical protein Csa_2G424720 [Cucumis sativus] Length = 73 Score = 86.3 bits (212), Expect = 7e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +3 Query: 252 KDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 K+W+TWAVKKAKVVTHYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 31 KEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_010915807.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Elaeis guineensis] Length = 69 Score = 85.9 bits (211), Expect = 1e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = +3 Query: 243 KFVKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 +FVK+WSTW +KKAKV+ HYGFIPL+I+IGMNSEPKP +SQLLSPV Sbjct: 24 RFVKEWSTWTMKKAKVIAHYGFIPLIIVIGMNSEPKPHLSQLLSPV 69 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +3 Query: 249 VKDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 VK WSTWA+KKAKV+THYGFIPL+IIIGMNSEPKP +SQLLSPV Sbjct: 29 VKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_008455820.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis melo] Length = 73 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +3 Query: 252 KDWSTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPSISQLLSPV 380 K+W+TWAVKKAKV+THYGFIPLVIIIGMNSEPKP +SQLLSPV Sbjct: 31 KEWTTWAVKKAKVITHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73