BLASTX nr result
ID: Forsythia22_contig00004146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00004146 (405 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006581925.1| PREDICTED: boron transporter 1-like isoform ... 69 1e-09 ref|XP_011071873.1| PREDICTED: probable boron transporter 2 [Ses... 69 2e-09 ref|XP_009800123.1| PREDICTED: probable boron transporter 2 [Nic... 69 2e-09 ref|XP_009600894.1| PREDICTED: probable boron transporter 2 isof... 69 2e-09 ref|XP_009600893.1| PREDICTED: probable boron transporter 2 isof... 69 2e-09 ref|XP_006578634.1| PREDICTED: boron transporter 1-like isoform ... 69 2e-09 ref|XP_011001527.1| PREDICTED: probable boron transporter 2 isof... 68 2e-09 ref|XP_011001525.1| PREDICTED: probable boron transporter 2 isof... 68 2e-09 ref|XP_006376863.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_002318053.2| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_006376862.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_006376861.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_006376860.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_006376859.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 ref|XP_006376858.1| hypothetical protein POPTR_0012s08340g [Popu... 68 2e-09 gb|EPS67271.1| hypothetical protein M569_07505, partial [Genlise... 68 2e-09 ref|XP_012478587.1| PREDICTED: probable boron transporter 2 isof... 67 5e-09 gb|KJB30289.1| hypothetical protein B456_005G135900 [Gossypium r... 67 5e-09 ref|XP_012478586.1| PREDICTED: probable boron transporter 2 isof... 67 5e-09 gb|KHG05664.1| Boron transporter 1 -like protein [Gossypium arbo... 67 5e-09 >ref|XP_006581925.1| PREDICTED: boron transporter 1-like isoform X3 [Glycine max] Length = 680 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 308 EGWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 EGWLRGFIADYGVPLMVLVWTAVSYIP N+VP Sbjct: 187 EGWLRGFIADYGVPLMVLVWTAVSYIPVNEVP 218 >ref|XP_011071873.1| PREDICTED: probable boron transporter 2 [Sesamum indicum] Length = 718 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTAVSYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAVSYIPVNDVP 259 >ref|XP_009800123.1| PREDICTED: probable boron transporter 2 [Nicotiana sylvestris] gi|698509864|ref|XP_009800124.1| PREDICTED: probable boron transporter 2 [Nicotiana sylvestris] Length = 724 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWT VSYIPANDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTGVSYIPANDVP 259 >ref|XP_009600894.1| PREDICTED: probable boron transporter 2 isoform X2 [Nicotiana tomentosiformis] Length = 683 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWT VSYIPANDVP Sbjct: 182 GWLRGFIADYGVPLMVLVWTGVSYIPANDVP 212 >ref|XP_009600893.1| PREDICTED: probable boron transporter 2 isoform X1 [Nicotiana tomentosiformis] Length = 730 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWT VSYIPANDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTGVSYIPANDVP 259 >ref|XP_006578634.1| PREDICTED: boron transporter 1-like isoform X2 [Glycine max] Length = 677 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 308 EGWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 EGWLRGFIADYGVPLMVL+WTAVSYIP N+VP Sbjct: 187 EGWLRGFIADYGVPLMVLIWTAVSYIPVNEVP 218 >ref|XP_011001527.1| PREDICTED: probable boron transporter 2 isoform X2 [Populus euphratica] Length = 680 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 189 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 219 >ref|XP_011001525.1| PREDICTED: probable boron transporter 2 isoform X1 [Populus euphratica] Length = 720 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >ref|XP_006376863.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326658|gb|ERP54660.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 653 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 162 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 192 >ref|XP_002318053.2| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326657|gb|EEE96273.2| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 718 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >ref|XP_006376862.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326656|gb|ERP54659.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 710 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 219 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 249 >ref|XP_006376861.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326655|gb|ERP54658.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 422 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >ref|XP_006376860.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326654|gb|ERP54657.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 630 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >ref|XP_006376859.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326653|gb|ERP54656.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 720 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >ref|XP_006376858.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] gi|550326652|gb|ERP54655.1| hypothetical protein POPTR_0012s08340g [Populus trichocarpa] Length = 527 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGFIADYGVPLMVLVWTA+SYIP NDVP Sbjct: 229 GWLRGFIADYGVPLMVLVWTAISYIPVNDVP 259 >gb|EPS67271.1| hypothetical protein M569_07505, partial [Genlisea aurea] Length = 283 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGF+ADYGVPLMVLVWTAVSYIP NDVP Sbjct: 229 GWLRGFVADYGVPLMVLVWTAVSYIPTNDVP 259 >ref|XP_012478587.1| PREDICTED: probable boron transporter 2 isoform X2 [Gossypium raimondii] Length = 702 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGF+ADYGVPLMVL+WTAVSYIP NDVP Sbjct: 216 GWLRGFVADYGVPLMVLLWTAVSYIPVNDVP 246 >gb|KJB30289.1| hypothetical protein B456_005G135900 [Gossypium raimondii] Length = 637 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGF+ADYGVPLMVL+WTAVSYIP NDVP Sbjct: 229 GWLRGFVADYGVPLMVLLWTAVSYIPVNDVP 259 >ref|XP_012478586.1| PREDICTED: probable boron transporter 2 isoform X1 [Gossypium raimondii] gi|763763034|gb|KJB30288.1| hypothetical protein B456_005G135900 [Gossypium raimondii] Length = 715 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGF+ADYGVPLMVL+WTAVSYIP NDVP Sbjct: 229 GWLRGFVADYGVPLMVLLWTAVSYIPVNDVP 259 >gb|KHG05664.1| Boron transporter 1 -like protein [Gossypium arboreum] Length = 715 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 311 GWLRGFIADYGVPLMVLVWTAVSYIPANDVP 403 GWLRGF+ADYGVPLMVL+WTAVSYIP NDVP Sbjct: 229 GWLRGFVADYGVPLMVLLWTAVSYIPVNDVP 259