BLASTX nr result
ID: Forsythia22_contig00003837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00003837 (212 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98476.1| unnamed protein product [Coffea canephora] 83 8e-14 >emb|CDO98476.1| unnamed protein product [Coffea canephora] Length = 140 Score = 82.8 bits (203), Expect = 8e-14 Identities = 37/66 (56%), Positives = 51/66 (77%) Frame = -3 Query: 201 ITVIQPITSFWSLCTKHASRAAKKLASGSPKSPLTKPKQLLMTVSNKALKFRRKKSSGEK 22 +++I+ I SFW+ CT+ AS+A KK A+ SPKSPL KPKQLL+T+SNKA+ F+ KK E+ Sbjct: 20 VSLIRSINSFWAKCTRQASKATKKFATNSPKSPLAKPKQLLVTLSNKAINFKHKKKVDEE 79 Query: 21 FGGDDD 4 F G+ D Sbjct: 80 FEGEID 85