BLASTX nr result
ID: Forsythia22_contig00000450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00000450 (375 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P06671.1|CB22_MAIZE RecName: Full=Chlorophyll a-b binding pro... 81 2e-13 ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays]... 81 2e-13 gb|ACF84273.1| unknown [Zea mays] gi|195619060|gb|ACG31360.1| ch... 81 2e-13 ref|NP_001132387.1| light harvesting complex mesophyll7 [Zea may... 81 2e-13 tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea m... 81 2e-13 ref|NP_001105427.1| light harvesting chlorophyll a /b binding pr... 81 2e-13 ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus no... 80 4e-13 ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus no... 80 4e-13 ref|XP_010091411.1| Chlorophyll a-b binding protein 16 [Morus no... 80 4e-13 prf||1615137B chlorophyll a/b binding protein P27 80 4e-13 ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 4... 80 4e-13 dbj|BAA00536.1| type I light-harvesting chlorophyll a/b-binding ... 80 4e-13 ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 2... 80 4e-13 ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 1... 80 4e-13 emb|CAA48410.1| light harvesting chlorophyll a /b binding protei... 80 4e-13 ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 4... 80 4e-13 gb|AKG50135.1| chloroplast chlorophyll a/b binding protein, part... 80 4e-13 ref|XP_012072079.1| PREDICTED: chlorophyll a-b binding protein o... 80 4e-13 ref|XP_006840304.2| PREDICTED: chlorophyll a-b binding protein o... 80 4e-13 ref|XP_012455127.1| PREDICTED: chlorophyll a-b binding protein o... 80 4e-13 >sp|P06671.1|CB22_MAIZE RecName: Full=Chlorophyll a-b binding protein, chloroplastic; AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor gi|22357|emb|CAA68451.1| LHCP [Zea mays] Length = 265 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 >ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays] gi|670390210|ref|XP_008675450.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Zea mays] gi|670390212|ref|XP_008675451.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Zea mays] gi|195619284|gb|ACG31472.1| chlorophyll a-b binding protein 2 [Zea mays] gi|414881723|tpg|DAA58854.1| TPA: chlorophyll a-b binding protein 2 [Zea mays] Length = 264 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 228 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 264 >gb|ACF84273.1| unknown [Zea mays] gi|195619060|gb|ACG31360.1| chlorophyll a-b binding protein 2 [Zea mays] Length = 266 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 230 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 266 >ref|NP_001132387.1| light harvesting complex mesophyll7 [Zea mays] gi|194694246|gb|ACF81207.1| unknown [Zea mays] Length = 185 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 149 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 185 >tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea mays] Length = 259 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 223 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 259 >ref|NP_001105427.1| light harvesting chlorophyll a /b binding protein [Zea mays] gi|22230|emb|CAA37474.1| light harvesting chlorophyll a /b binding protein [Zea mays] Length = 265 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 >ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis] gi|587880344|gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis] gi|587880343|gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_010091411.1| Chlorophyll a-b binding protein 16 [Morus notabilis] gi|587854385|gb|EXB44448.1| Chlorophyll a-b binding protein 16 [Morus notabilis] Length = 261 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 225 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 261 >prf||1615137B chlorophyll a/b binding protein P27 Length = 233 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGP+ENLADHIADPVNNNAWAYATNFVPGK Sbjct: 197 VQAIVTGKGPIENLADHIADPVNNNAWAYATNFVPGK 233 >ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana sylvestris] gi|3036955|dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 231 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267 >dbj|BAA00536.1| type I light-harvesting chlorophyll a/b-binding protein [Oryza sativa Japonica Group] gi|227611|prf||1707316A chlorophyll a/b binding protein 1 [Oryza sativa] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic [Nicotiana tomentosiformis] gi|115792|sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor [Nicotiana tabacum] gi|19823|emb|CAA36957.1| unnamed protein product [Nicotiana tabacum] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like [Nicotiana sylvestris] gi|3036949|dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 266 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 230 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 266 >emb|CAA48410.1| light harvesting chlorophyll a /b binding protein [Hedera helix] Length = 193 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 157 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 193 >ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana sylvestris] gi|3036948|dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 231 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267 >gb|AKG50135.1| chloroplast chlorophyll a/b binding protein, partial [Betula luminifera] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_012072079.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Jatropha curcas] Length = 265 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_006840304.2| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Amborella trichopoda] Length = 266 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 230 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 266 >ref|XP_012455127.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Gossypium raimondii] gi|763802778|gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii] Length = 264 Score = 80.5 bits (197), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 375 VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK 265 VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK Sbjct: 228 VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 264