BLASTX nr result
ID: Forsythia21_contig00062863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062863 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083510.1| PREDICTED: auxin-induced protein 6B-like [Se... 68 3e-09 ref|XP_011074993.1| PREDICTED: auxin-induced protein 6B-like [Se... 66 1e-08 emb|CDP07418.1| unnamed protein product [Coffea canephora] 66 1e-08 ref|XP_006342029.1| PREDICTED: auxin-induced protein 10A5-like [... 64 5e-08 ref|XP_004238340.1| PREDICTED: auxin-induced protein 10A5 [Solan... 64 5e-08 ref|XP_010095163.1| hypothetical protein L484_005120 [Morus nota... 62 2e-07 gb|KDO84796.1| hypothetical protein CISIN_1g043725mg [Citrus sin... 61 3e-07 ref|XP_006473631.1| PREDICTED: indole-3-acetic acid-induced prot... 61 3e-07 ref|XP_006435148.1| hypothetical protein CICLE_v10003150mg [Citr... 61 3e-07 ref|XP_002277332.1| PREDICTED: auxin-induced protein 6B-like [Vi... 60 4e-07 ref|XP_009783159.1| PREDICTED: auxin-induced protein 10A5-like [... 59 1e-06 ref|XP_009595511.1| PREDICTED: auxin-induced protein 10A5-like [... 59 1e-06 ref|XP_009786463.1| PREDICTED: indole-3-acetic acid-induced prot... 58 3e-06 ref|XP_009625794.1| PREDICTED: indole-3-acetic acid-induced prot... 58 3e-06 ref|XP_007041996.1| F10A5.20, putative [Theobroma cacao] gi|5087... 57 4e-06 emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] 57 4e-06 ref|XP_012073829.1| PREDICTED: auxin-induced protein 6B [Jatroph... 56 8e-06 ref|XP_007223677.1| hypothetical protein PRUPE_ppa012903mg [Prun... 56 8e-06 >ref|XP_011083510.1| PREDICTED: auxin-induced protein 6B-like [Sesamum indicum] Length = 148 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = -1 Query: 365 TDSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 T+S N SARF SFE+FQ +CHVG R+NLEF AESRPLLHG S+ Sbjct: 101 TESNMNSSARFMSFEEFQRHCHVGFRTNLEFWAESRPLLHGGSD 144 >ref|XP_011074993.1| PREDICTED: auxin-induced protein 6B-like [Sesamum indicum] Length = 149 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 362 DSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 +S ++S RF SFEDFQ YCHVG RSNLEF AESR LLHGVS+ Sbjct: 103 ESNVSNSNRFMSFEDFQRYCHVGFRSNLEFWAESRALLHGVSD 145 >emb|CDP07418.1| unnamed protein product [Coffea canephora] Length = 148 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -1 Query: 365 TDSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 ++S ++SARF + E+FQ YCHVGIRSNLEFLAESRPLL+G+++ Sbjct: 101 SESTHSNSARFMNLEEFQRYCHVGIRSNLEFLAESRPLLNGIAD 144 >ref|XP_006342029.1| PREDICTED: auxin-induced protein 10A5-like [Solanum tuberosum] Length = 149 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 362 DSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 +S KN+ F +FEDFQ YCHVGIRSNL+F A+SRPLL+G+S+ Sbjct: 103 ESDKNNVGCFINFEDFQRYCHVGIRSNLDFWADSRPLLNGISD 145 >ref|XP_004238340.1| PREDICTED: auxin-induced protein 10A5 [Solanum lycopersicum] Length = 149 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 362 DSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 +S KN+ F +FEDFQ YCHVGIRSNL+F A+SRPLL+G+S+ Sbjct: 103 ESDKNNVGCFINFEDFQRYCHVGIRSNLDFWADSRPLLNGISD 145 >ref|XP_010095163.1| hypothetical protein L484_005120 [Morus notabilis] gi|587869064|gb|EXB58393.1| hypothetical protein L484_005120 [Morus notabilis] Length = 153 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/45 (66%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -1 Query: 365 TDSGKNDSARFTSFEDFQTYCHVGI-RSNLEFLAESRPLLHGVSN 234 +DSG N S+RF + EDFQ YCHVG+ RSNL+F A+SRPLLHG+S+ Sbjct: 106 SDSG-NSSSRFLNLEDFQRYCHVGVRRSNLDFWADSRPLLHGLSD 149 >gb|KDO84796.1| hypothetical protein CISIN_1g043725mg [Citrus sinensis] Length = 150 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 S SARF +FEDFQ YCHVG + N++F ESRPLLHG+++ Sbjct: 105 SESGHSARFVNFEDFQRYCHVGFKKNIDFWTESRPLLHGIAS 146 >ref|XP_006473631.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Citrus sinensis] Length = 150 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 S SARF +FEDFQ YCHVG + N++F ESRPLLHG+++ Sbjct: 105 SESGHSARFVNFEDFQRYCHVGFKKNIDFWTESRPLLHGIAS 146 >ref|XP_006435148.1| hypothetical protein CICLE_v10003150mg [Citrus clementina] gi|557537270|gb|ESR48388.1| hypothetical protein CICLE_v10003150mg [Citrus clementina] Length = 150 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 S SARF +FEDFQ YCHVG + N++F ESRPLLHG+++ Sbjct: 105 SESGHSARFVNFEDFQRYCHVGFKKNIDFWTESRPLLHGIAS 146 >ref|XP_002277332.1| PREDICTED: auxin-induced protein 6B-like [Vitis vinifera] Length = 151 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSNW 231 S ++SARF + EDFQ YCHVGIRS+L+F ESRPLLH S W Sbjct: 109 SEASNSARFVNREDFQRYCHVGIRSSLDFWPESRPLLHSKSIW 151 >ref|XP_009783159.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana sylvestris] Length = 141 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 362 DSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLH 246 DS N+ +RF +FEDFQ YCH+ IRSNL+F +SRPLLH Sbjct: 103 DSANNNMSRFMNFEDFQRYCHMDIRSNLDFWGDSRPLLH 141 >ref|XP_009595511.1| PREDICTED: auxin-induced protein 10A5-like [Nicotiana tomentosiformis] Length = 141 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 362 DSGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLH 246 DS N+ +RF +FEDFQ YCH+ IRSNL+F +SRPLLH Sbjct: 103 DSANNNLSRFMNFEDFQRYCHMDIRSNLDFWGDSRPLLH 141 >ref|XP_009786463.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Nicotiana sylvestris] Length = 147 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -1 Query: 365 TDSGKNDSARFTSFEDFQTYC-HVGIRSNLEFLAESRPLLHGVSN 234 ++S KN+ F +FEDFQ YC H+G+RSNL+F A+SRPLL+GVS+ Sbjct: 99 SESDKNNVGCFINFEDFQRYCCHMGLRSNLDFWADSRPLLNGVSD 143 >ref|XP_009625794.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Nicotiana tomentosiformis] Length = 147 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -1 Query: 365 TDSGKNDSARFTSFEDFQTYC-HVGIRSNLEFLAESRPLLHGVSN 234 ++S KN+ F +FEDFQ YC H+G+RSNL+F A+SRPLL+GVS+ Sbjct: 99 SESDKNNVGCFINFEDFQRYCCHMGLRSNLDFWADSRPLLNGVSD 143 >ref|XP_007041996.1| F10A5.20, putative [Theobroma cacao] gi|508705931|gb|EOX97827.1| F10A5.20, putative [Theobroma cacao] Length = 160 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 SG ++S RF++FED Q CHVG+++ L F +ESRPLLHGV++ Sbjct: 112 SGSSNSGRFSAFEDLQRCCHVGMKNKLGFFSESRPLLHGVAD 153 >emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] Length = 200 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGV 240 S ++SARF + EDFQ YCHVGIRS+L+F ESRPLLH V Sbjct: 109 SEASNSARFVNREDFQRYCHVGIRSSLDFWPESRPLLHRV 148 >ref|XP_012073829.1| PREDICTED: auxin-induced protein 6B [Jatropha curcas] gi|643729008|gb|KDP36945.1| hypothetical protein JCGZ_08236 [Jatropha curcas] Length = 150 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 S +S RF++ EDFQ YCHVG+RS L+ ESRPLLHG ++ Sbjct: 105 SESGNSIRFSNLEDFQRYCHVGVRSTLDLWTESRPLLHGFAD 146 >ref|XP_007223677.1| hypothetical protein PRUPE_ppa012903mg [Prunus persica] gi|645229081|ref|XP_008221296.1| PREDICTED: auxin-induced protein 6B [Prunus mume] gi|462420613|gb|EMJ24876.1| hypothetical protein PRUPE_ppa012903mg [Prunus persica] Length = 150 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -1 Query: 359 SGKNDSARFTSFEDFQTYCHVGIRSNLEFLAESRPLLHGVSN 234 S S RF + +DFQ YCH GIRSNL+F A+SRPLL G S+ Sbjct: 105 SESGGSTRFVNLDDFQRYCHAGIRSNLDFWADSRPLLRGFSD 146