BLASTX nr result
ID: Forsythia21_contig00062500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062500 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090663.1| PREDICTED: meiotic recombination protein DMC... 147 3e-33 gb|ABP98984.1| DMC1 [Pilosella caespitosa] gi|145952328|gb|ABP98... 145 8e-33 ref|XP_012832391.1| PREDICTED: meiotic recombination protein DMC... 145 1e-32 gb|EYU41433.1| hypothetical protein MIMGU_mgv1a009723mg [Erythra... 145 1e-32 ref|XP_012069715.1| PREDICTED: meiotic recombination protein DMC... 145 1e-32 ref|XP_010107719.1| Meiotic recombination protein DMC1-like prot... 144 2e-32 ref|XP_010649965.1| PREDICTED: meiotic recombination protein DMC... 144 2e-32 ref|XP_010649964.1| PREDICTED: meiotic recombination protein DMC... 144 2e-32 emb|CBI26317.3| unnamed protein product [Vitis vinifera] 144 2e-32 emb|CAN71783.1| hypothetical protein VITISV_028799 [Vitis vinifera] 144 2e-32 ref|XP_010279269.1| PREDICTED: meiotic recombination protein DMC... 144 2e-32 ref|XP_010279268.1| PREDICTED: meiotic recombination protein DMC... 144 2e-32 ref|XP_010279267.1| PREDICTED: meiotic recombination protein DMC... 144 2e-32 gb|EPS59137.1| hypothetical protein M569_15672, partial [Genlise... 144 2e-32 ref|XP_012481166.1| PREDICTED: meiotic recombination protein DMC... 144 3e-32 gb|KJB28396.1| hypothetical protein B456_005G045700 [Gossypium r... 144 3e-32 ref|XP_010532584.1| PREDICTED: meiotic recombination protein DMC... 144 3e-32 ref|XP_002517062.1| meiotic recombination protein dmc1, putative... 144 3e-32 gb|KHN02759.1| Meiotic recombination protein DMC1 like [Glycine ... 143 5e-32 ref|XP_007034879.1| DNA repair family protein [Theobroma cacao] ... 143 5e-32 >ref|XP_011090663.1| PREDICTED: meiotic recombination protein DMC1 homolog [Sesamum indicum] Length = 343 Score = 147 bits (371), Expect = 3e-33 Identities = 72/76 (94%), Positives = 76/76 (100%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEAVEKIVNFGYITGSDALL+RKAV Sbjct: 45 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAVEKIVNFGYITGSDALLKRKAV 104 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 105 VRITTGSQALDELLGG 120 >gb|ABP98984.1| DMC1 [Pilosella caespitosa] gi|145952328|gb|ABP98985.1| DMC1 [Pilosella caespitosa] Length = 343 Score = 145 bits (367), Expect = 8e-33 Identities = 71/76 (93%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRKAV Sbjct: 45 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKAV 104 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 105 VRITTGSQALDELLGG 120 >ref|XP_012832391.1| PREDICTED: meiotic recombination protein DMC1 homolog [Erythranthe guttatus] Length = 343 Score = 145 bits (366), Expect = 1e-32 Identities = 71/76 (93%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEAVEKIVNFGYITGSDALL+RK V Sbjct: 45 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAVEKIVNFGYITGSDALLKRKQV 104 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 105 VRITTGSQALDELLGG 120 >gb|EYU41433.1| hypothetical protein MIMGU_mgv1a009723mg [Erythranthe guttata] Length = 333 Score = 145 bits (366), Expect = 1e-32 Identities = 71/76 (93%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEAVEKIVNFGYITGSDALL+RK V Sbjct: 44 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAVEKIVNFGYITGSDALLKRKQV 103 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 104 VRITTGSQALDELLGG 119 >ref|XP_012069715.1| PREDICTED: meiotic recombination protein DMC1 homolog [Jatropha curcas] gi|643733292|gb|KDP40239.1| hypothetical protein JCGZ_02237 [Jatropha curcas] Length = 344 Score = 145 bits (365), Expect = 1e-32 Identities = 71/76 (93%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 IRITTGSQALD+LLGG Sbjct: 106 IRITTGSQALDELLGG 121 >ref|XP_010107719.1| Meiotic recombination protein DMC1-like protein [Morus notabilis] gi|587929603|gb|EXC16754.1| Meiotic recombination protein DMC1-like protein [Morus notabilis] Length = 457 Score = 144 bits (364), Expect = 2e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 153 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 212 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 213 VRITTGSQALDELLGG 228 >ref|XP_010649965.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X2 [Vitis vinifera] Length = 344 Score = 144 bits (364), Expect = 2e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 106 VRITTGSQALDELLGG 121 >ref|XP_010649964.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X1 [Vitis vinifera] Length = 349 Score = 144 bits (364), Expect = 2e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 106 VRITTGSQALDELLGG 121 >emb|CBI26317.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 144 bits (364), Expect = 2e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 106 VRITTGSQALDELLGG 121 >emb|CAN71783.1| hypothetical protein VITISV_028799 [Vitis vinifera] Length = 348 Score = 144 bits (364), Expect = 2e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 106 VRITTGSQALDELLGG 121 >ref|XP_010279269.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X3 [Nelumbo nucifera] Length = 321 Score = 144 bits (363), Expect = 2e-32 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEA EKIVNFGYITGSD LLRRK+V Sbjct: 13 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDVLLRRKSV 72 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 73 VRITTGSQALDELLGG 88 >ref|XP_010279268.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X2 [Nelumbo nucifera] Length = 343 Score = 144 bits (363), Expect = 2e-32 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEA EKIVNFGYITGSD LLRRK+V Sbjct: 45 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDVLLRRKSV 104 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 105 VRITTGSQALDELLGG 120 >ref|XP_010279267.1| PREDICTED: meiotic recombination protein DMC1 homolog isoform X1 [Nelumbo nucifera] Length = 353 Score = 144 bits (363), Expect = 2e-32 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEA EKIVNFGYITGSD LLRRK+V Sbjct: 45 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDVLLRRKSV 104 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 105 VRITTGSQALDELLGG 120 >gb|EPS59137.1| hypothetical protein M569_15672, partial [Genlisea aurea] Length = 326 Score = 144 bits (363), Expect = 2e-32 Identities = 70/76 (92%), Positives = 76/76 (100%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVD+ICEAVEKIV+FGYITGSDALL+RK+V Sbjct: 35 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDKICEAVEKIVSFGYITGSDALLKRKSV 94 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 95 VRITTGSQALDELLGG 110 >ref|XP_012481166.1| PREDICTED: meiotic recombination protein DMC1 homolog [Gossypium raimondii] Length = 344 Score = 144 bits (362), Expect = 3e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALL+RK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLKRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 IRITTGSQALD+LLGG Sbjct: 106 IRITTGSQALDELLGG 121 >gb|KJB28396.1| hypothetical protein B456_005G045700 [Gossypium raimondii] Length = 340 Score = 144 bits (362), Expect = 3e-32 Identities = 70/76 (92%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALL+RK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLKRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 IRITTGSQALD+LLGG Sbjct: 106 IRITTGSQALDELLGG 121 >ref|XP_010532584.1| PREDICTED: meiotic recombination protein DMC1 homolog [Tarenaya hassleriana] Length = 344 Score = 144 bits (362), Expect = 3e-32 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGY+TGSDALL+RK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYMTGSDALLKRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALDDLLGG Sbjct: 106 VRITTGSQALDDLLGG 121 >ref|XP_002517062.1| meiotic recombination protein dmc1, putative [Ricinus communis] gi|223543697|gb|EEF45225.1| meiotic recombination protein dmc1, putative [Ricinus communis] Length = 353 Score = 144 bits (362), Expect = 3e-32 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EKIVNFGYITGSDALLRRK V Sbjct: 46 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYITGSDALLRRKQV 105 Query: 50 IRITTGSQALDDLLGG 3 +RITTGSQALD+LLGG Sbjct: 106 VRITTGSQALDELLGG 121 >gb|KHN02759.1| Meiotic recombination protein DMC1 like [Glycine soja] Length = 335 Score = 143 bits (360), Expect = 5e-32 Identities = 69/76 (90%), Positives = 75/76 (98%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK+LTGIKGLSEAKVD+ICEA EK+VNFGYITGSDALL+RK+V Sbjct: 47 KLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKLVNFGYITGSDALLKRKSV 106 Query: 50 IRITTGSQALDDLLGG 3 IRITTGSQALD+LLGG Sbjct: 107 IRITTGSQALDELLGG 122 >ref|XP_007034879.1| DNA repair family protein [Theobroma cacao] gi|508713908|gb|EOY05805.1| DNA repair family protein [Theobroma cacao] Length = 358 Score = 143 bits (360), Expect = 5e-32 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -3 Query: 230 KLQDAGIYTCNGLMMHTKKSLTGIKGLSEAKVDRICEAVEKIVNFGYITGSDALLRRKAV 51 KLQDAGIYTCNGLMMHTKK LTGIKGLSEAKVD+ICEA EKIVN+GYITGSDALLRRK+V Sbjct: 46 KLQDAGIYTCNGLMMHTKKHLTGIKGLSEAKVDKICEAAEKIVNYGYITGSDALLRRKSV 105 Query: 50 IRITTGSQALDDLLGG 3 IRITTGSQALD+LLGG Sbjct: 106 IRITTGSQALDELLGG 121