BLASTX nr result
ID: Forsythia21_contig00062246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062246 (402 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009355100.1| PREDICTED: uncharacterized protein LOC103946... 69 9e-10 ref|XP_009355099.1| PREDICTED: uncharacterized protein LOC103946... 69 9e-10 ref|XP_008231590.1| PREDICTED: uncharacterized protein LOC103330... 69 1e-09 ref|XP_012068747.1| PREDICTED: uncharacterized protein LOC105631... 69 1e-09 ref|XP_011085971.1| PREDICTED: uncharacterized protein LOC105167... 69 2e-09 emb|CDP20813.1| unnamed protein product [Coffea canephora] 69 2e-09 ref|XP_008346467.1| PREDICTED: uncharacterized protein LOC103409... 69 2e-09 gb|KDO47783.1| hypothetical protein CISIN_1g027583mg [Citrus sin... 68 3e-09 ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citr... 68 3e-09 ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citr... 68 3e-09 ref|XP_010645497.1| PREDICTED: uncharacterized protein LOC100264... 67 4e-09 ref|XP_010645473.1| PREDICTED: uncharacterized protein LOC100249... 67 4e-09 ref|XP_010645424.1| PREDICTED: uncharacterized protein LOC100263... 67 4e-09 ref|XP_010645422.1| PREDICTED: uncharacterized protein LOC100263... 67 4e-09 emb|CBI40627.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_010645423.1| PREDICTED: uncharacterized protein LOC100263... 67 4e-09 emb|CBI25812.3| unnamed protein product [Vitis vinifera] 67 4e-09 emb|CBI40636.3| unnamed protein product [Vitis vinifera] 67 4e-09 ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250... 67 4e-09 emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] 67 4e-09 >ref|XP_009355100.1| PREDICTED: uncharacterized protein LOC103946174 isoform X2 [Pyrus x bretschneideri] Length = 216 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VD+GLSWFTVKFH KS+GKAF AI G+CFGLA++LF VV Sbjct: 173 VDKGLSWFTVKFHFKSQGKAFAAIVGICFGLALVLFFVV 211 >ref|XP_009355099.1| PREDICTED: uncharacterized protein LOC103946174 isoform X1 [Pyrus x bretschneideri] Length = 218 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VD+GLSWFTVKFH KS+GKAF AI G+CFGLA++LF VV Sbjct: 175 VDKGLSWFTVKFHFKSQGKAFAAIVGICFGLALVLFFVV 213 >ref|XP_008231590.1| PREDICTED: uncharacterized protein LOC103330759 isoform X2 [Prunus mume] Length = 216 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 LVDRGLSWF+VKFH +S+GKAF AI G+CFGLA++LF VV Sbjct: 172 LVDRGLSWFSVKFHFESQGKAFTAIVGICFGLALVLFFVV 211 >ref|XP_012068747.1| PREDICTED: uncharacterized protein LOC105631285 isoform X1 [Jatropha curcas] gi|643733749|gb|KDP40592.1| hypothetical protein JCGZ_24591 [Jatropha curcas] Length = 216 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VDRGLSWFTVKF +S+GKAFMA+ G CFGLAI+LFLVV Sbjct: 173 VDRGLSWFTVKFKFESQGKAFMAVVGFCFGLAIILFLVV 211 >ref|XP_011085971.1| PREDICTED: uncharacterized protein LOC105167836 [Sesamum indicum] Length = 207 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VDRGLSWFT KF KS+GKAFMAIAGLCFGLA ++F++V Sbjct: 164 VDRGLSWFTAKFGFKSQGKAFMAIAGLCFGLAFLMFVIV 202 >emb|CDP20813.1| unnamed protein product [Coffea canephora] Length = 233 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VDRGLSWFT+K+ KS+GKAFMAIAG CFGLA M+FLV+ Sbjct: 190 VDRGLSWFTIKYKFKSQGKAFMAIAGFCFGLAFMVFLVL 228 >ref|XP_008346467.1| PREDICTED: uncharacterized protein LOC103409424 [Malus domestica] Length = 218 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -3 Query: 397 VDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 VD+GLSWFTVKFH KS+GKAF AI G CFGLA++LF VV Sbjct: 175 VDKGLSWFTVKFHFKSQGKAFAAIVGFCFGLALVLFFVV 213 >gb|KDO47783.1| hypothetical protein CISIN_1g027583mg [Citrus sinensis] Length = 221 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 LVDRGLSWFTVKF +++GKAFMAI G CFGLA++LFL V Sbjct: 177 LVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAV 216 >ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|557534453|gb|ESR45571.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 221 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 LVDRGLSWFTVKF +++GKAFMAI G CFGLA++LFL V Sbjct: 177 LVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAV 216 >ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|568834248|ref|XP_006471257.1| PREDICTED: uncharacterized protein LOC102618398 [Citrus sinensis] gi|557534452|gb|ESR45570.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 230 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 LVDRGLSWFTVKF +++GKAFMAI G CFGLA++LFL V Sbjct: 186 LVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAV 225 >ref|XP_010645497.1| PREDICTED: uncharacterized protein LOC100264237 [Vitis vinifera] Length = 213 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 169 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 208 >ref|XP_010645473.1| PREDICTED: uncharacterized protein LOC100249912 [Vitis vinifera] Length = 215 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 171 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 210 >ref|XP_010645424.1| PREDICTED: uncharacterized protein LOC100263253 isoform X3 [Vitis vinifera] Length = 145 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 101 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 140 >ref|XP_010645422.1| PREDICTED: uncharacterized protein LOC100263253 isoform X1 [Vitis vinifera] Length = 177 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 133 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 172 >emb|CBI40627.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 38 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 77 >ref|XP_010645423.1| PREDICTED: uncharacterized protein LOC100263253 isoform X2 [Vitis vinifera] gi|298205097|emb|CBI40618.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 109 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 148 >emb|CBI25812.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 169 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 208 >emb|CBI40636.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 69 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 108 >ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250564 [Vitis vinifera] Length = 215 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 171 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 210 >emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] Length = 132 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 400 LVDRGLSWFTVKFHLKSEGKAFMAIAGLCFGLAIMLFLVV 281 +VDRGLSWFTVKF +S+GKAFMAI G CFGLA++LF +V Sbjct: 88 IVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIV 127