BLASTX nr result
ID: Forsythia21_contig00062080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00062080 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] 54 8e-08 >emb|CAN81818.1| hypothetical protein VITISV_009635 [Vitis vinifera] Length = 1014 Score = 53.5 bits (127), Expect(3) = 8e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 1 VLATSPFPSLEEAYSLVCREL*RQVTMGTKVYSETSSFGYSK 126 VL+TSP PSLEEAYSLV RE RQVTMGT+ Y E+S+ K Sbjct: 805 VLSTSPLPSLEEAYSLVRREAHRQVTMGTEDYFESSAMAIHK 846 Score = 28.1 bits (61), Expect(3) = 8e-08 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = +2 Query: 110 ALAIQNNNSRLTTFS---ISTGSYTHCCSNRH 196 A+AI NN++ TTF+ S+ THC S RH Sbjct: 841 AMAIHKNNTQPTTFTPIDSSSRFCTHCNSTRH 872 Score = 20.4 bits (41), Expect(3) = 8e-08 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +3 Query: 198 VDVCWKLH 221 +DVCW+ H Sbjct: 874 IDVCWRKH 881