BLASTX nr result
ID: Forsythia21_contig00061878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00061878 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075547.1| PREDICTED: nudix hydrolase 25-like [Sesamum ... 58 2e-06 ref|XP_012844102.1| PREDICTED: nudix hydrolase 25 [Erythranthe g... 57 6e-06 >ref|XP_011075547.1| PREDICTED: nudix hydrolase 25-like [Sesamum indicum] Length = 172 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/75 (42%), Positives = 38/75 (50%) Frame = -1 Query: 333 EWVTPEEVIELVF*NLLPK*Y*VLHYNLQTFVKRLICDFLY*AVDYKRPSYEKVMKAFQP 154 +W TPEEVIE AVDYKRP+YE+VMK F+P Sbjct: 129 KWATPEEVIEQ-------------------------------AVDYKRPTYEEVMKTFRP 157 Query: 153 YLNSRKATKSYSSKW 109 + NS KATK YS+KW Sbjct: 158 HFNSGKATKCYSTKW 172 >ref|XP_012844102.1| PREDICTED: nudix hydrolase 25 [Erythranthe guttatus] gi|604321236|gb|EYU31827.1| hypothetical protein MIMGU_mgv1a014958mg [Erythranthe guttata] Length = 172 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 207 AVDYKRPSYEKVMKAFQPYLNSRKATKSYSSKW 109 AVDYKRP+YE+VMK F+PY +S KATK YS+KW Sbjct: 140 AVDYKRPTYEEVMKKFRPYFDSGKATKCYSTKW 172