BLASTX nr result
ID: Forsythia21_contig00061730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00061730 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL07334.1| rpoB [Glycine max] 51 9e-10 gb|ADD31192.1| RNA polymerase beta subunit protein (chloroplast)... 47 1e-08 gb|AGE93448.1| RNA polymerase beta subunit [Xiphidium caeruleum] 48 1e-08 ref|YP_009127607.1| RNA polymerase beta subunit (chloroplast) [P... 47 1e-08 gb|AFB18322.1| RNA polymerase beta subunit, partial [Apostasia w... 47 2e-08 gb|AFB18327.1| RNA polymerase beta subunit, partial [Chamaedorea... 45 2e-08 gb|AEX94350.1| RNA polymerase beta subunit (chloroplast) [Ledebo... 47 2e-08 ref|YP_001718693.1| RNA polymerase beta subunit [Trachelium caer... 47 2e-08 gb|AFK81465.1| RNA polymerase beta subunit [Camellia taliensis] 47 2e-08 ref|YP_008520131.1| DNA-directed RNA polymerase beta subunit (ch... 47 2e-08 gb|AFB18341.1| RNA polymerase beta subunit, partial [Kingia aust... 47 2e-08 ref|YP_009144507.1| RNA polymerase beta subunit (chloroplast) [R... 47 2e-08 ref|YP_008146118.1| RNA polymerase beta subunit (chloroplast) [G... 47 2e-08 ref|YP_008146036.1| RNA polymerase beta subunit (chloroplast) [G... 47 2e-08 ref|YP_008145790.1| RNA polymerase beta subunit (chloroplast) [G... 47 2e-08 ref|YP_008145342.1| RNA polymerase beta subunit (chloroplast) [G... 47 2e-08 ref|YP_008145709.1| RNA polymerase beta subunit (chloroplast) [G... 47 2e-08 ref|YP_538763.1| RNA polymerase beta subunit [Glycine max] gi|55... 47 2e-08 gb|ADD31190.1| RNA polymerase beta subunit protein (chloroplast)... 45 2e-08 ref|YP_007475953.1| RNA polymerase beta subunit [Bismarckia nobi... 45 2e-08 >gb|AAL07334.1| rpoB [Glycine max] Length = 1070 Score = 51.2 bits (121), Expect(2) = 9e-10 Identities = 29/43 (67%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSYSILEDQKG 311 L +YESF +HP SQVLDQT PLTQI GRKLSY LED G Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSYLGLEDLTG 403 Score = 38.1 bits (87), Expect(2) = 9e-10 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >gb|ADD31192.1| RNA polymerase beta subunit protein (chloroplast) [Meliosma aff. cuneifolia Moore 333] Length = 1070 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 39.3 bits (90), Expect(2) = 1e-08 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E VV+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENVVRGTICGAIRHKWIPT 351 >gb|AGE93448.1| RNA polymerase beta subunit [Xiphidium caeruleum] Length = 1080 Score = 47.8 bits (112), Expect(2) = 1e-08 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 S LK +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 359 STSLKTAYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 396 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E V+G IC +IRHK + T Sbjct: 324 DQFGLALARLENAVRGTICGAIRHKLIPT 352 >ref|YP_009127607.1| RNA polymerase beta subunit (chloroplast) [Pachyrhizus erosus] Length = 1070 Score = 46.6 bits (109), Expect(2) = 1e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.9 bits (89), Expect(2) = 1e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENIVRGTICGAIRHKLIPT 351 >gb|AFB18322.1| RNA polymerase beta subunit, partial [Apostasia wallichii] Length = 1081 Score = 47.4 bits (111), Expect(2) = 2e-08 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 S L +YESF ++HP SQVLDQT PLTQI GRKLSY Sbjct: 369 STSLTTTYESFFALHPLSQVLDQTNPLTQIVHGRKLSY 406 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E V+G IC +IRHK + T Sbjct: 334 DQFGLALVRLENAVRGTICGAIRHKLIPT 362 >gb|AFB18327.1| RNA polymerase beta subunit, partial [Chamaedorea seifrizii] Length = 1079 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 S L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 367 STSLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 404 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E VQG IC +IRHK + T Sbjct: 332 DQFGLALVRLENAVQGTICGAIRHKLIPT 360 >gb|AEX94350.1| RNA polymerase beta subunit (chloroplast) [Ledebouria cordifolia] Length = 1070 Score = 47.4 bits (111), Expect(2) = 2e-08 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 SI L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 358 SISLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 37.4 bits (85), Expect(2) = 2e-08 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E ++G IC +IRHK + T Sbjct: 323 DQFGLALVRLENAIRGTICGAIRHKLIPT 351 >ref|YP_001718693.1| RNA polymerase beta subunit [Trachelium caeruleum] gi|156598804|gb|ABU85655.1| RNA polymerase beta subunit [Trachelium caeruleum] gi|157267525|gb|ABV26518.1| RNA polymerase beta subunit (chloroplast) [Trachelium caeruleum] Length = 1070 Score = 47.4 bits (111), Expect(2) = 2e-08 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 S LL +Y+SF +HP SQVLDQT PLTQI GRKLSY Sbjct: 358 SPLLTTTYDSFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 37.4 bits (85), Expect(2) = 2e-08 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK 139 DQ+GLAL R EKVV+ IC ++RHK Sbjct: 323 DQFGLALVRLEKVVRSTICGALRHK 347 >gb|AFK81465.1| RNA polymerase beta subunit [Camellia taliensis] Length = 1070 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L I+YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 361 LTITYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ GLAL R E VV+G IC +IRHK + T Sbjct: 323 DQLGLALVRLENVVRGTICGAIRHKLIPT 351 >ref|YP_008520131.1| DNA-directed RNA polymerase beta subunit (chloroplast) [Camellia taliensis] gi|537362674|gb|AGU44479.1| DNA-directed RNA polymerase beta subunit (chloroplast) [Camellia taliensis] gi|537362944|gb|AGU44746.1| DNA-directed RNA polymerase beta subunit (chloroplast) [Camellia taliensis] Length = 1070 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L I+YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 361 LTITYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ GLAL R E VV+G IC +IRHK + T Sbjct: 323 DQLGLALVRLENVVRGTICGAIRHKLIPT 351 >gb|AFB18341.1| RNA polymerase beta subunit, partial [Kingia australis] gi|392841330|gb|AFM83285.1| RNA polymerase beta subunit (chloroplast) [Kingia australis] Length = 1070 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = +3 Query: 162 RNFN*SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 RN S L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 353 RNLVTSTSLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 37.7 bits (86), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENAVRGTICGAIRHKLIPT 351 >ref|YP_009144507.1| RNA polymerase beta subunit (chloroplast) [Rosmarinus officinalis] gi|827345134|gb|AKJ76718.1| RNA polymerase beta subunit (chloroplast) [Rosmarinus officinalis] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = +3 Query: 162 RNFN*SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 RN S L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 353 RNLVTSTPLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GL+L R E VV+G IC +IRHK + T Sbjct: 323 DQFGLSLVRLENVVRGTICGAIRHKLIPT 351 >ref|YP_008146118.1| RNA polymerase beta subunit (chloroplast) [Glycine syndetika] gi|514253394|gb|AGO44649.1| RNA polymerase beta subunit (chloroplast) [Glycine syndetika] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >ref|YP_008146036.1| RNA polymerase beta subunit (chloroplast) [Glycine falcata] gi|514253311|gb|AGO44567.1| RNA polymerase beta subunit (chloroplast) [Glycine falcata] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >ref|YP_008145790.1| RNA polymerase beta subunit (chloroplast) [Glycine stenophita] gi|514253062|gb|AGO44321.1| RNA polymerase beta subunit (chloroplast) [Glycine stenophita] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >ref|YP_008145342.1| RNA polymerase beta subunit (chloroplast) [Glycine tomentella] gi|526176062|ref|YP_008145872.1| RNA polymerase beta subunit (chloroplast) [Glycine canescens] gi|526176149|ref|YP_008145954.1| RNA polymerase beta subunit (chloroplast) [Glycine dolichocarpa] gi|514252979|gb|AGO44239.1| RNA polymerase beta subunit (chloroplast) [Glycine tomentella] gi|514253145|gb|AGO44403.1| RNA polymerase beta subunit (chloroplast) [Glycine canescens] gi|514253228|gb|AGO44485.1| RNA polymerase beta subunit (chloroplast) [Glycine dolichocarpa] gi|514253476|gb|AGO44730.1| RNA polymerase beta subunit (chloroplast) [Glycine tomentella] gi|514253558|gb|AGO44811.1| RNA polymerase beta subunit (chloroplast) [Glycine tomentella] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >ref|YP_008145709.1| RNA polymerase beta subunit (chloroplast) [Glycine cyrtoloba] gi|514252897|gb|AGO44158.1| RNA polymerase beta subunit (chloroplast) [Glycine cyrtoloba] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >ref|YP_538763.1| RNA polymerase beta subunit [Glycine max] gi|558604135|ref|YP_008816245.1| RNA polymerase beta subunit (chloroplast) [Glycine soja] gi|88984774|sp|Q8HVY5.2|RPOB_SOYBN RecName: Full=DNA-directed RNA polymerase subunit beta; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta; Short=RNA polymerase subunit beta gi|83595742|gb|ABC25123.1| RNA polymerase beta subunit [Glycine max] gi|507588316|gb|AGM51207.1| RNA polymerase beta subunit (chloroplast) [Glycine soja] gi|557469727|gb|AHA03980.1| RNA polymerase beta subunit (chloroplast) [Glycine soja] Length = 1070 Score = 46.6 bits (109), Expect(2) = 2e-08 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLDQT PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDQTNPLTQIVHGRKLSY 395 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E +V+G IC +IRHK + T Sbjct: 323 DQFGLALVRLENMVRGTICGAIRHKLIPT 351 >gb|ADD31190.1| RNA polymerase beta subunit protein (chloroplast) [Ilex cornuta] Length = 1070 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +3 Query: 186 LKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 361 LTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 395 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LSTFIIS*LQLINST 187 DQ+GLAL R E VV+G IC +IRHK FI + L+ ST Sbjct: 323 DQFGLALVRLENVVRGTICGAIRHK----FIPTPQNLVTST 359 >ref|YP_007475953.1| RNA polymerase beta subunit [Bismarckia nobilis] gi|449326436|gb|AGE93018.1| RNA polymerase beta subunit [Bismarckia nobilis] Length = 1069 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 25/38 (65%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = +3 Query: 177 SILLKISYESF-SVHP*SQVLDQTIPLTQISRGRKLSY 287 S L +YESF +HP SQVLD+T PLTQI GRKLSY Sbjct: 356 STSLTTTYESFFGLHPLSQVLDRTNPLTQIVHGRKLSY 393 Score = 39.3 bits (90), Expect(2) = 2e-08 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = +2 Query: 65 DQYGLALTR*EKVVQGIICSSIRHK*LST 151 DQ+GLAL R E VV+G IC +IRHK + T Sbjct: 321 DQFGLALVRLENVVRGTICGAIRHKLIPT 349