BLASTX nr result
ID: Forsythia21_contig00061604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00061604 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99958.1| unnamed protein product [Coffea canephora] 69 2e-09 ref|XP_009764432.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_009615421.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_004250548.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_012837331.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_006352475.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_009777621.1| PREDICTED: putative pentatricopeptide repeat... 64 3e-08 ref|XP_009373739.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_008341824.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_006404168.1| hypothetical protein EUTSA_v10010119mg [Eutr... 64 3e-08 ref|XP_006290593.1| hypothetical protein CARUB_v10016682mg [Caps... 64 3e-08 ref|NP_190486.2| pentatricopeptide repeat-containing protein [Ar... 64 3e-08 ref|XP_012491037.1| PREDICTED: putative pentatricopeptide repeat... 64 4e-08 gb|KJB42736.1| hypothetical protein B456_007G166400 [Gossypium r... 64 4e-08 ref|XP_012831924.1| PREDICTED: putative pentatricopeptide repeat... 64 5e-08 ref|XP_011626687.1| PREDICTED: putative pentatricopeptide repeat... 64 5e-08 gb|EYU41633.1| hypothetical protein MIMGU_mgv1a000836mg [Erythra... 64 5e-08 ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_010426426.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 >emb|CDO99958.1| unnamed protein product [Coffea canephora] Length = 641 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MKYVS+ T KIILRDTNRFHHFD+G CSCNDYW Sbjct: 608 MKYVSKATSRKIILRDTNRFHHFDKGTCSCNDYW 641 >ref|XP_009764432.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Nicotiana sylvestris] Length = 646 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK+VSE+T KII+RDTNRFHHFD+G CSCNDYW Sbjct: 613 MKFVSEITRRKIIVRDTNRFHHFDKGICSCNDYW 646 >ref|XP_009615421.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Nicotiana tomentosiformis] Length = 646 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK+VSE+T KII+RDTNRFHHFD+G CSCNDYW Sbjct: 613 MKFVSEITRRKIIVRDTNRFHHFDKGICSCNDYW 646 >ref|XP_004250548.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Solanum lycopersicum] gi|723742047|ref|XP_010312728.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Solanum lycopersicum] Length = 646 Score = 66.6 bits (161), Expect = 6e-09 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK+VSE+T +II+RDTNRFHHFD+G+CSCN+YW Sbjct: 613 MKFVSEITRRRIIVRDTNRFHHFDQGKCSCNEYW 646 >ref|XP_012837331.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Erythranthe guttatus] gi|604333047|gb|EYU37438.1| hypothetical protein MIMGU_mgv1a002659mg [Erythranthe guttata] Length = 649 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK+VSEV +IILRDTNRFHHF++G+CSCNDYW Sbjct: 616 MKHVSEVRQRRIILRDTNRFHHFEDGKCSCNDYW 649 >ref|XP_006352475.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Solanum tuberosum] Length = 646 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK VSE+T +II+RDTNRFHHFD+G+CSCN+YW Sbjct: 613 MKVVSEITRRRIIVRDTNRFHHFDQGKCSCNEYW 646 >ref|XP_011082278.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Sesamum indicum] Length = 649 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MK+ S+V+ KIILRDTNRFHHF EG+CSCNDYW Sbjct: 616 MKHASKVSKRKIILRDTNRFHHFHEGKCSCNDYW 649 >ref|XP_009777621.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451446|ref|XP_009777628.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451450|ref|XP_009777638.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451454|ref|XP_009777645.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451458|ref|XP_009777652.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] gi|698451463|ref|XP_009777661.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Nicotiana sylvestris] Length = 1059 Score = 64.3 bits (155), Expect = 3e-08 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KY+S+V G +I+LRD+NRFHHF +G+CSCNDYW Sbjct: 1027 KYISQVVGRQIVLRDSNRFHHFSDGKCSCNDYW 1059 >ref|XP_009373739.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Pyrus x bretschneideri] Length = 845 Score = 64.3 bits (155), Expect = 3e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 +KY+SE TG +I++RD+NRFHHF +GRCSCN+YW Sbjct: 812 IKYISEATGREIVVRDSNRFHHFKDGRCSCNEYW 845 >ref|XP_008341824.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic [Malus domestica] Length = 845 Score = 64.3 bits (155), Expect = 3e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 +KY+SE TG +I++RD+NRFHHF +GRCSCN+YW Sbjct: 812 IKYISEATGREIVVRDSNRFHHFKDGRCSCNEYW 845 >ref|XP_006404168.1| hypothetical protein EUTSA_v10010119mg [Eutrema salsugineum] gi|557105287|gb|ESQ45621.1| hypothetical protein EUTSA_v10010119mg [Eutrema salsugineum] Length = 850 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MKY++ V+G +I+LRD NRFHHF +GRCSCNDYW Sbjct: 817 MKYITTVSGREIVLRDLNRFHHFKDGRCSCNDYW 850 >ref|XP_006290593.1| hypothetical protein CARUB_v10016682mg [Capsella rubella] gi|482559300|gb|EOA23491.1| hypothetical protein CARUB_v10016682mg [Capsella rubella] Length = 850 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MKY+S V+G +I+LRD NRFHHF +G+CSCNDYW Sbjct: 817 MKYISTVSGREIVLRDLNRFHHFKDGKCSCNDYW 850 >ref|NP_190486.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75222188|sp|Q5G1T1.1|PP272_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49170, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2261; Flags: Precursor gi|58013018|gb|AAW62962.1| embryo-defective 2261 [Arabidopsis thaliana] gi|58013020|gb|AAW62963.1| embryo-defective 2261 [Arabidopsis thaliana] gi|332644986|gb|AEE78507.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 850 Score = 64.3 bits (155), Expect = 3e-08 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MKY+S V+G +I+LRD NRFHHF +G+CSCNDYW Sbjct: 817 MKYISTVSGREIVLRDLNRFHHFKDGKCSCNDYW 850 >ref|XP_012491037.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Gossypium raimondii] Length = 1078 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KY+S++ G IILRD+NRFHHFDEG+CSC DYW Sbjct: 1046 KYISKIVGRVIILRDSNRFHHFDEGKCSCGDYW 1078 >gb|KJB42736.1| hypothetical protein B456_007G166400 [Gossypium raimondii] Length = 851 Score = 63.9 bits (154), Expect = 4e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KY+S++ G IILRD+NRFHHFDEG+CSC DYW Sbjct: 819 KYISKIVGRVIILRDSNRFHHFDEGKCSCGDYW 851 >ref|XP_012831924.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Erythranthe guttatus] Length = 1077 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KYVSE+ G +I+LRD+NRFHHF G+CSCNDYW Sbjct: 1045 KYVSEIVGRRIVLRDSNRFHHFAGGKCSCNDYW 1077 >ref|XP_011626687.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Amborella trichopoda] Length = 967 Score = 63.5 bits (153), Expect = 5e-08 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KY+SE+ G +I+LRD+NRFHHF++G+CSC DYW Sbjct: 935 KYISEIVGRQIVLRDSNRFHHFEDGKCSCRDYW 967 >gb|EYU41633.1| hypothetical protein MIMGU_mgv1a000836mg [Erythranthe guttata] Length = 967 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 247 KYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 KYVSE+ G +I+LRD+NRFHHF G+CSCNDYW Sbjct: 935 KYVSEIVGRRIVLRDSNRFHHFAGGKCSCNDYW 967 >ref|XP_011038297.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330 [Populus euphratica] Length = 648 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 +K VS VTG I+LRDTNRFHHF EG CSCNDYW Sbjct: 615 IKIVSRVTGRVIVLRDTNRFHHFKEGACSCNDYW 648 >ref|XP_010426426.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Camelina sativa] Length = 865 Score = 63.2 bits (152), Expect = 7e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 250 MKYVSEVTGSKIILRDTNRFHHFDEGRCSCNDYW 149 MKY+S V+G +I+LRD NRFHHF G+CSCNDYW Sbjct: 832 MKYISSVSGREIVLRDLNRFHHFKGGKCSCNDYW 865