BLASTX nr result
ID: Forsythia21_contig00061510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00061510 (425 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14602.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_008392174.1| PREDICTED: serine/threonine-protein kinase N... 57 5e-06 ref|XP_011037828.1| PREDICTED: serine/threonine-protein kinase N... 57 6e-06 ref|XP_007014976.1| NIMA-related kinase 7 [Theobroma cacao] gi|5... 56 8e-06 >emb|CDP14602.1| unnamed protein product [Coffea canephora] Length = 467 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 148 MEIPSKKTKSKMDDYEVLEQIGRGSFGAAFLVHHXXXXXXXXXXKIRLA 2 ME +++ KSKM+DYEV+EQIGRG+FGAA LVHH KIRLA Sbjct: 1 MESVNREAKSKMEDYEVIEQIGRGAFGAALLVHHKIEKKKYVLKKIRLA 49 >ref|XP_008392174.1| PREDICTED: serine/threonine-protein kinase Nek6-like [Malus domestica] gi|657999477|ref|XP_008392175.1| PREDICTED: serine/threonine-protein kinase Nek6-like [Malus domestica] gi|657999479|ref|XP_008392176.1| PREDICTED: serine/threonine-protein kinase Nek6-like [Malus domestica] Length = 636 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 148 MEIPSKKTKSKMDDYEVLEQIGRGSFGAAFLVHHXXXXXXXXXXKIRL 5 MEI +TKSKM+DYEV+EQIGRG+FGAAFLV H KIRL Sbjct: 1 MEIDDAETKSKMEDYEVIEQIGRGAFGAAFLVLHKTQKKKYVLKKIRL 48 >ref|XP_011037828.1| PREDICTED: serine/threonine-protein kinase Nek6-like isoform X1 [Populus euphratica] Length = 566 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -2 Query: 148 MEIPSKKTKSKMDDYEVLEQIGRGSFGAAFLVHHXXXXXXXXXXKIRLA 2 ME +K+ SKMDDYEVLEQIGRG+FGAAFLV H KIRLA Sbjct: 1 METKNKEMVSKMDDYEVLEQIGRGTFGAAFLVLHKFENKRYVLKKIRLA 49 >ref|XP_007014976.1| NIMA-related kinase 7 [Theobroma cacao] gi|508785339|gb|EOY32595.1| NIMA-related kinase 7 [Theobroma cacao] Length = 576 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 148 MEIPSKKTKSKMDDYEVLEQIGRGSFGAAFLVHHXXXXXXXXXXKIRLA 2 ME +++ SKMDDY+V+EQIGRG+FGAAFLVHH KIRLA Sbjct: 1 MEKKNQEMISKMDDYQVIEQIGRGAFGAAFLVHHKAEKNKYVLKKIRLA 49