BLASTX nr result
ID: Forsythia21_contig00060806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00060806 (463 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077861.1| PREDICTED: alpha carbonic anhydrase 1, chlor... 56 8e-06 >ref|XP_011077861.1| PREDICTED: alpha carbonic anhydrase 1, chloroplastic-like [Sesamum indicum] Length = 282 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 92 YRFAAELHLVHVADDGNVSVVGILFQLGHP 3 +R+AAELHLVH+ADDGNVSVV ILF+ GHP Sbjct: 135 FRYAAELHLVHIADDGNVSVVAILFKYGHP 164