BLASTX nr result
ID: Forsythia21_contig00059996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00059996 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107867.1| DNA-directed RNA polymerase II subunit [Moru... 57 4e-06 ref|XP_010090457.1| Solanesyl diphosphate synthase 3 [Morus nota... 56 8e-06 >ref|XP_010107867.1| DNA-directed RNA polymerase II subunit [Morus notabilis] gi|587930138|gb|EXC17267.1| DNA-directed RNA polymerase II subunit [Morus notabilis] Length = 588 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +2 Query: 140 QFVNFVKDVMHRIILGWMKWKSGTRVL*DCNTSIKLKNVFFRTFTRLDMLCGSELWS 310 Q+ + +D+ H+I +GW+KWK+ T VL D IKLK F+RT RL ML GSE W+ Sbjct: 397 QYEDIEEDIQHKIKVGWVKWKNATGVLCDDKMPIKLKGKFYRT-VRLAMLYGSERWA 452 >ref|XP_010090457.1| Solanesyl diphosphate synthase 3 [Morus notabilis] gi|587849282|gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis] Length = 670 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = +2 Query: 158 KDVMHRIILGWMKWKSGTRVL*DCNTSIKLKNVFFRTFTRLDMLCGSELWS 310 +D+ HRI GW+KWK+ T VL D IKLK F+RT R ML GSE W+ Sbjct: 488 EDIEHRIKAGWVKWKNVTGVLCDVEMPIKLKGKFYRTVIRPAMLYGSECWA 538