BLASTX nr result
ID: Forsythia21_contig00059676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00059676 (425 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ91195.1| glycoside hydrolase family 17 protein [Aureobasid... 65 1e-08 gb|KEQ81063.1| glycoside hydrolase [Aureobasidium pullulans EXF-... 65 2e-08 >gb|KEQ91195.1| glycoside hydrolase family 17 protein [Aureobasidium subglaciale EXF-2481] Length = 427 Score = 65.5 bits (158), Expect = 1e-08 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = -1 Query: 230 QPSGH-RRHQHLHEKRDDVVTIVDY--VTSQLPDVVVYVDEKGNVLSTVTSGQVA 75 +PSGH RRHQ LHEKR +VV DY VT+QLP+VVVYVDE G ST T GQ A Sbjct: 21 KPSGHHRRHQELHEKRQEVVYETDYSYVTTQLPNVVVYVDENGAPYSTSTEGQAA 75 >gb|KEQ81063.1| glycoside hydrolase [Aureobasidium pullulans EXF-150] Length = 435 Score = 64.7 bits (156), Expect = 2e-08 Identities = 36/62 (58%), Positives = 42/62 (67%), Gaps = 3/62 (4%) Frame = -1 Query: 230 QPSGH-RRHQHLHEKRDDVVTIVDY--VTSQLPDVVVYVDEKGNVLSTVTSGQVATPAPV 60 +PSGH RRHQ LHEKR +VV DY VT+QLP+VVV+VDE G ST T GQ A + Sbjct: 20 KPSGHHRRHQELHEKRQEVVYETDYSYVTTQLPNVVVFVDENGAPYSTSTEGQAAATSAA 79 Query: 59 PV 54 V Sbjct: 80 AV 81