BLASTX nr result
ID: Forsythia21_contig00058766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00058766 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN52429.1| hypothetical protein Csa_5G633270 [Cucumis sativus] 61 3e-07 >gb|KGN52429.1| hypothetical protein Csa_5G633270 [Cucumis sativus] Length = 101 Score = 60.8 bits (146), Expect = 3e-07 Identities = 35/93 (37%), Positives = 49/93 (52%), Gaps = 12/93 (12%) Frame = -1 Query: 245 MITLQRSDVSFRRQGSSGLIWDDRLKMLQRKSGV-------LYNTEKGEQKHTQDLKRK- 90 M TLQRS +SFRRQGSSGLIW+D ++ L+ K+G + + E + +D K Sbjct: 1 MTTLQRSSISFRRQGSSGLIWEDNVRALEAKTGARATASTSVMSQELSQSSGERDETPKS 60 Query: 89 ----EIDXXXXXXXXXRENKTQGCSFSALFGRC 3 E++ Q CSFS++FGRC Sbjct: 61 DGLDEVNSSSSPSTPPERTTPQKCSFSSVFGRC 93