BLASTX nr result
ID: Forsythia21_contig00058663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00058663 (616 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68619.1| hypothetical protein M569_06149, partial [Genlise... 63 1e-07 ref|XP_011090904.1| PREDICTED: peptide methionine sulfoxide redu... 60 1e-06 ref|XP_004134168.1| PREDICTED: peptide methionine sulfoxide redu... 60 1e-06 ref|XP_012832380.1| PREDICTED: peptide methionine sulfoxide redu... 59 2e-06 ref|XP_008438751.1| PREDICTED: peptide methionine sulfoxide redu... 58 4e-06 ref|XP_006365283.1| PREDICTED: peptide methionine sulfoxide redu... 57 9e-06 >gb|EPS68619.1| hypothetical protein M569_06149, partial [Genlisea aurea] Length = 130 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -3 Query: 158 LNLLNSNVQFGSILHSKDAH*QFNSCTEPRGTGEYDKFYDEGIYNCTGCGTP 3 L + S ++ +IL ++ H TEPRGTG YDKFYD+G+YNC GCGTP Sbjct: 2 LPIQKSEEEWRAILSPEEFHILRQKGTEPRGTGHYDKFYDDGVYNCAGCGTP 53 >ref|XP_011090904.1| PREDICTED: peptide methionine sulfoxide reductase B5-like [Sesamum indicum] Length = 153 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 143 SNVQFGSILHSKDAH*QFNSCTEPRGTGEYDKFYDEGIYNCTGCGTP 3 S ++ +IL + H TEP+GTG YDKFY+EGIYNC GCGTP Sbjct: 11 SEEEWRAILTPEQFHILREKGTEPKGTGHYDKFYEEGIYNCAGCGTP 57 >ref|XP_004134168.1| PREDICTED: peptide methionine sulfoxide reductase B5 [Cucumis sativus] gi|700201910|gb|KGN57043.1| hypothetical protein Csa_3G150230 [Cucumis sativus] Length = 139 Score = 59.7 bits (143), Expect = 1e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 80 TEPRGTGEYDKFYDEGIYNCTGCGTP 3 TEPRGTG+YDKFY+EGIYNC GCGTP Sbjct: 34 TEPRGTGKYDKFYEEGIYNCAGCGTP 59 >ref|XP_012832380.1| PREDICTED: peptide methionine sulfoxide reductase B5-like [Erythranthe guttatus] gi|604342515|gb|EYU41545.1| hypothetical protein MIMGU_mgv1a016103mg [Erythranthe guttata] Length = 134 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = -3 Query: 143 SNVQFGSILHSKDAH*QFNSCTEPRGTGEYDKFYDEGIYNCTGCGTP 3 S ++ +IL + H TEP+GTG YDKFYDEG+Y C GCGTP Sbjct: 11 SEEEWRAILSPEQFHILRQKGTEPKGTGHYDKFYDEGVYKCAGCGTP 57 >ref|XP_008438751.1| PREDICTED: peptide methionine sulfoxide reductase B5-like isoform X2 [Cucumis melo] gi|659076572|ref|XP_008438752.1| PREDICTED: peptide methionine sulfoxide reductase B5-like isoform X2 [Cucumis melo] Length = 139 Score = 57.8 bits (138), Expect = 4e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 80 TEPRGTGEYDKFYDEGIYNCTGCGTP 3 TEPRGTG+YDKFY+EGIY+C GCGTP Sbjct: 34 TEPRGTGKYDKFYEEGIYHCAGCGTP 59 >ref|XP_006365283.1| PREDICTED: peptide methionine sulfoxide reductase B5-like [Solanum tuberosum] Length = 135 Score = 56.6 bits (135), Expect = 9e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 80 TEPRGTGEYDKFYDEGIYNCTGCGTP 3 TE +GTGEYDKFYDEG+YNC GCGTP Sbjct: 27 TELKGTGEYDKFYDEGMYNCAGCGTP 52