BLASTX nr result
ID: Forsythia21_contig00058556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00058556 (352 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_011099914.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 107 4e-21 ref|XP_009777873.1| PREDICTED: pentatricopeptide repeat-containi... 106 5e-21 ref|XP_012065865.1| PREDICTED: pentatricopeptide repeat-containi... 106 7e-21 gb|KDP46745.1| hypothetical protein JCGZ_06533 [Jatropha curcas] 106 7e-21 ref|XP_009608057.1| PREDICTED: pentatricopeptide repeat-containi... 105 9e-21 ref|XP_012832803.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 gb|EYU41210.1| hypothetical protein MIMGU_mgv1a020437mg [Erythra... 105 1e-20 ref|XP_010061020.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 gb|KDO84746.1| hypothetical protein CISIN_1g0038681mg, partial [... 104 2e-20 gb|KCW67919.1| hypothetical protein EUGRSUZ_F01621 [Eucalyptus g... 104 2e-20 emb|CBI19832.3| unnamed protein product [Vitis vinifera] 104 2e-20 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citr... 104 2e-20 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_010271478.1| PREDICTED: pentatricopeptide repeat-containi... 103 6e-20 >ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum tuberosum] Length = 804 Score = 111 bits (277), Expect = 2e-22 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIRVFKNLRICGDCHNAFKFMSK EAREIIVRDG RFHHFRDG CSCGNYW Sbjct: 754 TIRVFKNLRICGDCHNAFKFMSKVEAREIIVRDGNRFHHFRDGECSCGNYW 804 >ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Solanum lycopersicum] gi|723696460|ref|XP_010320488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Solanum lycopersicum] Length = 804 Score = 111 bits (277), Expect = 2e-22 Identities = 48/51 (94%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIRVFKNLRICGDCHNAFKFMSK EAREIIVRDG RFHHFRDG CSCGNYW Sbjct: 754 TIRVFKNLRICGDCHNAFKFMSKVEAREIIVRDGNRFHHFRDGECSCGNYW 804 >ref|XP_011099914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Sesamum indicum] Length = 811 Score = 110 bits (276), Expect = 3e-22 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIR+FKNLRICGDCHNA KFMSKAEAREIIVRDGKRFHHF+DG CSCGNYW Sbjct: 761 TIRIFKNLRICGDCHNAIKFMSKAEAREIIVRDGKRFHHFKDGECSCGNYW 811 >ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] gi|743851265|ref|XP_011028951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] gi|743851269|ref|XP_011028952.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Populus euphratica] Length = 797 Score = 107 bits (266), Expect = 4e-21 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFKFMSK REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 747 TVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 107 bits (266), Expect = 4e-21 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFKFMSK REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 747 TVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >ref|XP_009777873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana sylvestris] gi|698582613|ref|XP_009777874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana sylvestris] gi|698582616|ref|XP_009777875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana sylvestris] Length = 807 Score = 106 bits (265), Expect = 5e-21 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIRVFKNLRICGDCHNA KFMSK EA EIIVRDG RFHHFRDG CSCGNYW Sbjct: 757 TIRVFKNLRICGDCHNAIKFMSKVEASEIIVRDGNRFHHFRDGECSCGNYW 807 >ref|XP_012065865.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Jatropha curcas] Length = 797 Score = 106 bits (264), Expect = 7e-21 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFK+MSK +REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 747 TVRVFKNLRICGDCHNAFKYMSKVVSREIVVRDGKRFHHFRDGKCSCGDYW 797 >gb|KDP46745.1| hypothetical protein JCGZ_06533 [Jatropha curcas] Length = 161 Score = 106 bits (264), Expect = 7e-21 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFK+MSK +REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 111 TVRVFKNLRICGDCHNAFKYMSKVVSREIVVRDGKRFHHFRDGKCSCGDYW 161 >ref|XP_009608057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana tomentosiformis] gi|697108401|ref|XP_009608058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana tomentosiformis] gi|697108403|ref|XP_009608059.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana tomentosiformis] gi|697108405|ref|XP_009608061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nicotiana tomentosiformis] Length = 807 Score = 105 bits (263), Expect = 9e-21 Identities = 46/51 (90%), Positives = 46/51 (90%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIRVFKNLRICGDCHNA KFMSK EAREIIVRDG RFHHFRDG CSC NYW Sbjct: 757 TIRVFKNLRICGDCHNAIKFMSKVEAREIIVRDGNRFHHFRDGECSCRNYW 807 >ref|XP_012832803.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Erythranthe guttatus] gi|848864099|ref|XP_012832804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Erythranthe guttatus] Length = 811 Score = 105 bits (262), Expect = 1e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIR+FKNLRICGDCHNA KFMSKAE REIIVRD KRFHHF+DG CSCGNYW Sbjct: 761 TIRIFKNLRICGDCHNAVKFMSKAEGREIIVRDVKRFHHFKDGECSCGNYW 811 >gb|EYU41210.1| hypothetical protein MIMGU_mgv1a020437mg [Erythranthe guttata] Length = 680 Score = 105 bits (262), Expect = 1e-20 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIR+FKNLRICGDCHNA KFMSKAE REIIVRD KRFHHF+DG CSCGNYW Sbjct: 630 TIRIFKNLRICGDCHNAVKFMSKAEGREIIVRDVKRFHHFKDGECSCGNYW 680 >ref|XP_010061020.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Eucalyptus grandis] Length = 799 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCH+AFKFMS A REI+VRDGKRFHHF+DG CSCGNYW Sbjct: 749 TVRVFKNLRICGDCHSAFKFMSSAVGREIVVRDGKRFHHFKDGECSCGNYW 799 >gb|KDO84746.1| hypothetical protein CISIN_1g0038681mg, partial [Citrus sinensis] Length = 519 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RV KNLRICGDCHNAFKFMSK REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 469 TVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 519 >gb|KCW67919.1| hypothetical protein EUGRSUZ_F01621 [Eucalyptus grandis] Length = 759 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCH+AFKFMS A REI+VRDGKRFHHF+DG CSCGNYW Sbjct: 709 TVRVFKNLRICGDCHSAFKFMSSAVGREIVVRDGKRFHHFKDGECSCGNYW 759 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFKFMSK REI+VRDGKRFHHF++G CSCGNYW Sbjct: 494 TVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Citrus sinensis] gi|568839239|ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Citrus sinensis] Length = 799 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RV KNLRICGDCHNAFKFMSK REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 749 TVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] gi|557537225|gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RV KNLRICGDCHNAFKFMSK REI+VRDGKRFHHFRDG+CSCG+YW Sbjct: 749 TVRVLKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 799 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 104 bits (260), Expect = 2e-20 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RVFKNLRICGDCHNAFKFMSK REI+VRDGKRFHHF++G CSCGNYW Sbjct: 749 TVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] gi|828302618|ref|XP_012569722.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] Length = 795 Score = 103 bits (257), Expect = 4e-20 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 TIRVFKNLRICGDCHNAFKF+SK AREI+VRD KRFHHFR+G CSCGNYW Sbjct: 745 TIRVFKNLRICGDCHNAFKFISKVVAREIVVRDRKRFHHFRNGECSCGNYW 795 >ref|XP_010271478.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nelumbo nucifera] Length = 801 Score = 103 bits (256), Expect = 6e-20 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +1 Query: 1 TIRVFKNLRICGDCHNAFKFMSKAEAREIIVRDGKRFHHFRDGRCSCGNYW 153 T+RV KNLRICGDCH AFKFMSK REI+VRDGKRFHHFRDG CSCGNYW Sbjct: 751 TVRVLKNLRICGDCHTAFKFMSKVVEREIVVRDGKRFHHFRDGECSCGNYW 801