BLASTX nr result
ID: Forsythia21_contig00057213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00057213 (502 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094357.1| PREDICTED: putative F-box protein At5g62660 ... 62 1e-16 >ref|XP_011094357.1| PREDICTED: putative F-box protein At5g62660 [Sesamum indicum] Length = 371 Score = 62.0 bits (149), Expect(3) = 1e-16 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -1 Query: 244 QEILIHTEQKGLISYSTKNRTSRTI*YLEAVRSCNKACIHHQSLYPLHMT 95 +EILIHTEQKGLI Y+ + +TSR I Y E VRS NK C++H + PL T Sbjct: 318 EEILIHTEQKGLIGYNVRTQTSRRIKYFEGVRSYNKPCLYHYCISPLCTT 367 Score = 49.7 bits (117), Expect(3) = 1e-16 Identities = 27/56 (48%), Positives = 33/56 (58%) Frame = -3 Query: 419 NLASSTIQHAILMESTAIRGSLFFACCSSETSIDLWTLKDKNEKIWVLEFSISLFP 252 N S ++ +E I+GSLF CS+ETS L DK+EK WVLE ISLFP Sbjct: 249 NYPSCDVKTYSFLEFAGIKGSLFVLGCSAETSTMAVWLLDKDEKSWVLEHRISLFP 304 Score = 20.8 bits (42), Expect(3) = 1e-16 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 423 KEFSIINYPT 394 ++FSIINYP+ Sbjct: 243 EDFSIINYPS 252