BLASTX nr result
ID: Forsythia21_contig00057198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00057198 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ69357.1| hypothetical protein M436DRAFT_56341 [Aureobasidi... 82 1e-13 gb|KEQ91316.1| hypothetical protein AUEXF2481DRAFT_44311 [Aureob... 73 8e-11 gb|KEQ62576.1| hypothetical protein M437DRAFT_75695 [Aureobasidi... 66 8e-09 gb|KEQ83341.1| WSC-domain-containing protein [Aureobasidium pull... 62 1e-07 >gb|KEQ69357.1| hypothetical protein M436DRAFT_56341 [Aureobasidium namibiae CBS 147.97] Length = 290 Score = 82.4 bits (202), Expect = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 306 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDIDY 205 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDIDY Sbjct: 90 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDIDY 123 >gb|KEQ91316.1| hypothetical protein AUEXF2481DRAFT_44311 [Aureobasidium subglaciale EXF-2481] Length = 295 Score = 72.8 bits (177), Expect = 8e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 306 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDIDY 205 SKC+ ACVGYPTD CGGNGYWSVYFTTT+TDI+Y Sbjct: 85 SKCSLACVGYPTDTCGGNGYWSVYFTTTETDINY 118 >gb|KEQ62576.1| hypothetical protein M437DRAFT_75695 [Aureobasidium melanogenum CBS 110374] Length = 310 Score = 66.2 bits (160), Expect = 8e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 306 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDIDY 205 SKC+ CVGYP D+CGG+GYWSVY+TTTDT+I Y Sbjct: 90 SKCSMTCVGYPDDICGGDGYWSVYYTTTDTNIGY 123 >gb|KEQ83341.1| WSC-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 299 Score = 62.0 bits (149), Expect = 1e-07 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -1 Query: 306 SKCNKACVGYPTDVCGGNGYWSVYFTTTDTDID 208 S+C+ CVGYP+D+CGGNG WSVY+T++DTD+D Sbjct: 90 SECSTTCVGYPSDMCGGNGVWSVYYTSSDTDVD 122