BLASTX nr result
ID: Forsythia21_contig00057063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00057063 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO82083.1| hypothetical protein CISIN_1g047058mg, partial [C... 57 5e-06 ref|XP_006484334.1| PREDICTED: anther-specific proline-rich prot... 57 5e-06 ref|XP_006438155.1| hypothetical protein CICLE_v10033695mg [Citr... 57 5e-06 >gb|KDO82083.1| hypothetical protein CISIN_1g047058mg, partial [Citrus sinensis] Length = 301 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = +3 Query: 6 DLRKSINWDGIHFTEAMEKNLANLFLNQGSCRHSFDEMIIRKR 134 D + ++WDGIH TEAM K++A+LFLNQG C+ SF E++ +KR Sbjct: 257 DPSRLMHWDGIHLTEAMYKHIADLFLNQGYCKPSFQELVKKKR 299 >ref|XP_006484334.1| PREDICTED: anther-specific proline-rich protein APG-like [Citrus sinensis] Length = 678 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = +3 Query: 6 DLRKSINWDGIHFTEAMEKNLANLFLNQGSCRHSFDEMIIRKR 134 D + ++WDGIH TEAM K++A+LFLNQG C+ SF E++ +KR Sbjct: 634 DPSRLMHWDGIHLTEAMYKHIADLFLNQGYCKPSFQELVKKKR 676 >ref|XP_006438155.1| hypothetical protein CICLE_v10033695mg [Citrus clementina] gi|557540351|gb|ESR51395.1| hypothetical protein CICLE_v10033695mg [Citrus clementina] Length = 327 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = +3 Query: 6 DLRKSINWDGIHFTEAMEKNLANLFLNQGSCRHSFDEMIIRKR 134 D + ++WDGIH TEAM K++A+LFLNQG C+ SF E++ +KR Sbjct: 283 DPSRLMHWDGIHLTEAMYKHIADLFLNQGYCKPSFQELVKKKR 325