BLASTX nr result
ID: Forsythia21_contig00057001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00057001 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009790563.1| PREDICTED: uncharacterized protein LOC104238... 59 2e-06 ref|XP_011079570.1| PREDICTED: uncharacterized protein LOC105163... 57 4e-06 ref|XP_009616219.1| PREDICTED: uncharacterized protein LOC104108... 57 5e-06 >ref|XP_009790563.1| PREDICTED: uncharacterized protein LOC104238005 [Nicotiana sylvestris] Length = 585 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 141 DPCTTTMAASPSLTGGEKKHWWLTNKKMVE 230 DPCT+TMAASP+L+ GEKKHWW++NKK+VE Sbjct: 4 DPCTSTMAASPTLSCGEKKHWWISNKKIVE 33 >ref|XP_011079570.1| PREDICTED: uncharacterized protein LOC105163060 [Sesamum indicum] Length = 583 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +3 Query: 135 MVDPCTTTMA-ASPSLTGGEKKHWWLTNKKMVE 230 MVD C T+MA A+PS+ GGEKKHWWLTN+KMVE Sbjct: 1 MVDSCNTSMAVATPSIVGGEKKHWWLTNRKMVE 33 >ref|XP_009616219.1| PREDICTED: uncharacterized protein LOC104108800 [Nicotiana tomentosiformis] Length = 580 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +3 Query: 141 DPCTTTMAASPSLTGGEKKHWWLTNKKMVE 230 +PCT+TMAASP+L+ GEKKHWW++NKK+VE Sbjct: 4 EPCTSTMAASPTLSCGEKKHWWISNKKIVE 33