BLASTX nr result
ID: Forsythia21_contig00056371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056371 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001211238.1| GTP-binding protein ypt7 [Aspergillus terreu... 72 1e-10 emb|CRG83995.1| putative Ras-related protein Rab7 [Talaromyces i... 71 2e-10 gb|KKY36460.1| putative ras-like protein rab7 [Diaporthe ampelina] 71 3e-10 gb|KJZ71889.1| Putative Ras-related protein Rab7 [Hirsutella min... 71 3e-10 gb|KJJ32771.1| Ras family protein [Aspergillus flavus AF70] 71 3e-10 gb|KEY73294.1| hypothetical protein S7711_01413 [Stachybotrys ch... 71 3e-10 gb|KEQ81474.1| ras-related protein-like protein [Aureobasidium p... 71 3e-10 gb|AAX07679.1| ras-related protein-like protein [Magnaporthe gri... 71 3e-10 gb|EYE94058.1| hypothetical protein EURHEDRAFT_413670 [Aspergill... 71 3e-10 ref|XP_003050527.1| predicted protein [Nectria haematococca mpVI... 71 3e-10 ref|XP_007834203.1| Ras-related protein Rab7 [Pestalotiopsis fic... 71 3e-10 ref|XP_011109544.1| hypothetical protein H072_3574 [Dactylellina... 71 3e-10 ref|XP_008077693.1| P-loop containing nucleoside triphosphate hy... 71 3e-10 ref|XP_007785189.1| Ras-like protein Rab7 [Coniosporium apollini... 71 3e-10 gb|AFQ38857.1| GTP-binding protein Ypt7 [Magnaporthe oryzae] 71 3e-10 ref|XP_007274041.1| rab small monomeric gtpase [Colletotrichum g... 71 3e-10 ref|XP_001824054.1| Ras-related protein Rab7 [Aspergillus oryzae... 71 3e-10 ref|XP_009216461.1| Ras-like protein Rab7 [Gaeumannomyces gramin... 71 3e-10 ref|XP_006696898.1| rab small monomeric GTPase-like protein [Cha... 71 3e-10 ref|XP_001398680.2| Ras-related protein Rab7 [Aspergillus niger ... 71 3e-10 >ref|XP_001211238.1| GTP-binding protein ypt7 [Aspergillus terreus NIH2624] gi|114195322|gb|EAU37022.1| GTP-binding protein ypt7 [Aspergillus terreus NIH2624] Length = 280 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 113 AMSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 AMSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 56 AMSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 92 >emb|CRG83995.1| putative Ras-related protein Rab7 [Talaromyces islandicus] Length = 279 Score = 71.2 bits (173), Expect = 2e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -2 Query: 113 AMSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 AM+SRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 73 AMASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 109 >gb|KKY36460.1| putative ras-like protein rab7 [Diaporthe ampelina] Length = 206 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|KJZ71889.1| Putative Ras-related protein Rab7 [Hirsutella minnesotensis 3608] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|KJJ32771.1| Ras family protein [Aspergillus flavus AF70] Length = 207 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|KEY73294.1| hypothetical protein S7711_01413 [Stachybotrys chartarum IBT 7711] gi|667526727|gb|KFA55112.1| hypothetical protein S40293_03565 [Stachybotrys chartarum IBT 40293] gi|667719812|gb|KFA62148.1| hypothetical protein S40285_01640 [Stachybotrys chlorohalonata IBT 40285] gi|667738663|gb|KFA77828.1| hypothetical protein S40288_00463 [Stachybotrys chartarum IBT 40288] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|KEQ81474.1| ras-related protein-like protein [Aureobasidium pullulans EXF-150] gi|662538381|gb|KEQ95687.1| hypothetical protein AUEXF2481DRAFT_39541 [Aureobasidium subglaciale EXF-2481] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|AAX07679.1| ras-related protein-like protein [Magnaporthe grisea] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|EYE94058.1| hypothetical protein EURHEDRAFT_413670 [Aspergillus ruber CBS 135680] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_003050527.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|685861797|ref|XP_009257931.1| hypothetical protein FPSE_06538 [Fusarium pseudograminearum CS3096] gi|758202562|ref|XP_011323641.1| GTP-binding protein ypt7 [Fusarium graminearum PH-1] gi|256731464|gb|EEU44814.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342879328|gb|EGU80581.1| hypothetical protein FOXB_08912 [Fusarium oxysporum Fo5176] gi|408394017|gb|EKJ73273.1| hypothetical protein FPSE_06538 [Fusarium pseudograminearum CS3096] gi|475671043|gb|EMT68396.1| Putative Ras-related protein Rab7 [Fusarium oxysporum f. sp. cubense race 4] gi|477516248|gb|ENH68529.1| Putative Ras-related protein Rab7 [Fusarium oxysporum f. sp. cubense race 1] gi|517315212|emb|CCT67180.1| probable GTPase Rab7 protein [Fusarium fujikuroi IMI 58289] gi|558860982|gb|ESU11065.1| GTP-binding protein ypt7 [Fusarium graminearum PH-1] gi|584133884|gb|EWG43257.1| Ras-like protein Rab7 [Fusarium verticillioides 7600] gi|587679770|gb|EWZ02088.1| Ras-like protein Rab7 [Fusarium oxysporum FOSC 3-a] gi|587701537|gb|EWZ48142.1| Ras-like protein Rab7 [Fusarium oxysporum Fo47] gi|587721877|gb|EWZ93214.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587744558|gb|EXA42274.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. pisi HDV247] gi|590043616|gb|EXK45474.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. melonis 26406] gi|590069734|gb|EXK97258.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. raphani 54005] gi|591418338|gb|EXL53475.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591447739|gb|EXL80167.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591475589|gb|EXM06761.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591504357|gb|EXM33680.1| Ras-like protein Rab7 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596552534|gb|EYB31890.1| hypothetical protein FG05_05141 [Fusarium graminearum] gi|699034637|emb|CEF86602.1| unnamed protein product [Fusarium graminearum] gi|751353716|gb|KIL91438.1| ras-like protein rab7 [Fusarium avenaceum] gi|829114899|gb|KLO91285.1| putative GTPase Rab7 protein [Fusarium fujikuroi] gi|829129245|gb|KLP03949.1| putative GTPase Rab7 protein [Fusarium fujikuroi] gi|829150449|gb|KLP19030.1| putative GTPase Rab7 protein [Fusarium fujikuroi] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_007834203.1| Ras-related protein Rab7 [Pestalotiopsis fici W106-1] gi|573060140|gb|ETS79902.1| Ras-related protein Rab7 [Pestalotiopsis fici W106-1] Length = 209 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_011109544.1| hypothetical protein H072_3574 [Dactylellina haptotyla CBS 200.50] gi|526202057|gb|EPS42487.1| hypothetical protein H072_3574 [Dactylellina haptotyla CBS 200.50] Length = 207 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_008077693.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] gi|512206795|gb|EPE35614.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis ATCC 20868] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_007785189.1| Ras-like protein Rab7 [Coniosporium apollinis CBS 100218] gi|494834170|gb|EON69872.1| Ras-like protein Rab7 [Coniosporium apollinis CBS 100218] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >gb|AFQ38857.1| GTP-binding protein Ypt7 [Magnaporthe oryzae] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_007274041.1| rab small monomeric gtpase [Colletotrichum gloeosporioides Nara gc5] gi|429862214|gb|ELA36871.1| rab small monomeric gtpase [Colletotrichum gloeosporioides Nara gc5] gi|477526925|gb|ENH78778.1| RAB small monomeric GTPase [Colletotrichum orbiculare MAFF 240422] gi|530472304|gb|EQB52939.1| hypothetical protein CGLO_07396 [Colletotrichum gloeosporioides Cg-14] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_001824054.1| Ras-related protein Rab7 [Aspergillus oryzae RIB40] gi|46403855|gb|AAS92973.1| vacuolar biogenesis protein [Aspergillus parasiticus] gi|46403857|gb|AAS92974.1| vacuolar biogenesis protein [Aspergillus parasiticus] gi|83772793|dbj|BAE62921.1| unnamed protein product [Aspergillus oryzae RIB40] gi|391874233|gb|EIT83154.1| Ras-related GTPase [Aspergillus oryzae 3.042] gi|635511197|gb|KDE83108.1| Ras-related GTPase [Aspergillus oryzae 100-8] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_009216461.1| Ras-like protein Rab7 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402085554|gb|EJT80452.1| Ras-like protein Rab7 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|835896710|gb|KLU88431.1| Ras-like protein Rab7 [Magnaporthiopsis poae ATCC 64411] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_006696898.1| rab small monomeric GTPase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340904912|gb|EGS17280.1| rab small monomeric GTPase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36 >ref|XP_001398680.2| Ras-related protein Rab7 [Aspergillus niger CBS 513.88] gi|350630527|gb|EHA18899.1| hypothetical protein ASPNIDRAFT_54109 [Aspergillus niger ATCC 1015] Length = 205 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 3 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS Sbjct: 1 MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSAS 36