BLASTX nr result
ID: Forsythia21_contig00056250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056250 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX93213.1| hypothetical protein TI39_contig4364g00003 [Zymos... 91 4e-16 ref|XP_003852638.1| hypothetical protein MYCGRDRAFT_42293 [Zymos... 69 2e-09 ref|XP_001258683.1| hypothetical protein NFIA_001340 [Neosartory... 58 2e-06 ref|XP_748394.1| conserved hypothetical protein [Aspergillus fum... 57 5e-06 >gb|KJX93213.1| hypothetical protein TI39_contig4364g00003 [Zymoseptoria brevis] Length = 272 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/81 (50%), Positives = 57/81 (70%) Frame = -2 Query: 252 LNNRVDDLFTKYVALSDNMPFPSASKAKINSIFAARFGLTNLEDMALSADAREALFIGFE 73 LN +D LFTK+VAL NMPF + + + +IFA R G+ +L+D+ ++ + REA+F+ FE Sbjct: 117 LNQHIDGLFTKHVALCSNMPFDPSVEDECMAIFAKRAGVKSLDDVKMTPEQREAMFVSFE 176 Query: 72 NALGEFAKAYAHTGGTTDTVW 10 + LGE AK Y H GGTTD VW Sbjct: 177 DTLGELAKVYRHEGGTTDYVW 197 >ref|XP_003852638.1| hypothetical protein MYCGRDRAFT_42293 [Zymoseptoria tritici IPO323] gi|339472519|gb|EGP87614.1| hypothetical protein MYCGRDRAFT_42293 [Zymoseptoria tritici IPO323] Length = 248 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/74 (45%), Positives = 46/74 (62%) Frame = -2 Query: 252 LNNRVDDLFTKYVALSDNMPFPSASKAKINSIFAARFGLTNLEDMALSADAREALFIGFE 73 LN +D LFTK+V L MPF + K + +IFA R G+ +LED+ ++ REA+F+ FE Sbjct: 117 LNQHIDGLFTKHVGLCSTMPFDPSVKDECMAIFAKRAGVKSLEDVKMTPKQREAMFVSFE 176 Query: 72 NALGEFAKAYAHTG 31 ALGE AK G Sbjct: 177 AALGELAKRSGRQG 190 >ref|XP_001258683.1| hypothetical protein NFIA_001340 [Neosartorya fischeri NRRL 181] gi|119406836|gb|EAW16786.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 248 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -2 Query: 258 SDLNNRVDDLFTKYVALS-DNMPFPSASKAKINSIFAARFGLTNLEDMALSADAREALFI 82 S N++VD +FT++ L MPF A+ + + FA R G ED+ ++ +AR + Sbjct: 117 SAFNSQVDAVFTQHCVLCVQGMPFNPATAEESKAAFAKRAGKERYEDLMITGEARAGMLK 176 Query: 81 GFENALGEFAKAYAHTGG 28 F+NALGE AKAY T G Sbjct: 177 SFQNALGELAKAYRRTEG 194 >ref|XP_748394.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66846023|gb|EAL86356.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159128471|gb|EDP53586.1| conserved hypothetical protein [Aspergillus fumigatus A1163] gi|666435478|gb|KEY82924.1| hypothetical protein BA78_5596 [Aspergillus fumigatus var. RP-2014] gi|846912935|gb|KMK58787.1| hypothetical protein Y699_08014 [Aspergillus fumigatus Z5] Length = 248 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -2 Query: 258 SDLNNRVDDLFTKYVALS-DNMPFPSASKAKINSIFAARFGLTNLEDMALSADAREALFI 82 S N++VD +FT++ L MP+ A+ + + FA R G ED+ ++ +AR + Sbjct: 117 SAFNSQVDAVFTQHCVLCVQGMPYNPATAEESKATFAKRAGKERYEDLMITGEARAGILE 176 Query: 81 GFENALGEFAKAYAHTGG 28 F+NALGE AKAY T G Sbjct: 177 SFQNALGELAKAYRRTEG 194