BLASTX nr result
ID: Forsythia21_contig00056086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00056086 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091438.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 >ref|XP_011091438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Sesamum indicum] gi|747087771|ref|XP_011091439.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Sesamum indicum] Length = 763 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = +1 Query: 106 MIARQVKLKTFSRILVQKPRDLRIFCSFYHGRHMLDENPRPSFVSFHRCMLDSIH 270 MI R++KL+ F +ILVQ+ + L+ CSF G H+LDE P+P FVS HR ML+ ++ Sbjct: 1 MITRRLKLEIFHKILVQQSKHLKNSCSFSRGYHVLDETPKPPFVSVHRFMLNLLY 55