BLASTX nr result
ID: Forsythia21_contig00055993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055993 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ74044.1| hypothetical protein M436DRAFT_72425 [Aureobasidi... 62 1e-07 gb|KEQ64557.1| hypothetical protein M437DRAFT_73514 [Aureobasidi... 59 1e-06 gb|KEQ84352.1| hypothetical protein M438DRAFT_374480 [Aureobasid... 58 2e-06 >gb|KEQ74044.1| hypothetical protein M436DRAFT_72425 [Aureobasidium namibiae CBS 147.97] Length = 205 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 247 NAQQSAGDAGLPKQKGVSNDGQFDVLKDASA 155 NAQQSAGDAG+PK KGVSNDGQFDVLKDASA Sbjct: 175 NAQQSAGDAGIPKDKGVSNDGQFDVLKDASA 205 >gb|KEQ64557.1| hypothetical protein M437DRAFT_73514 [Aureobasidium melanogenum CBS 110374] Length = 199 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 247 NAQQSAGDAGLPKQKGVSNDGQFDVLKDASA 155 NAQQSAGDA LPKQ+GVSNDGQFDVLKD SA Sbjct: 169 NAQQSAGDAALPKQQGVSNDGQFDVLKDTSA 199 >gb|KEQ84352.1| hypothetical protein M438DRAFT_374480 [Aureobasidium pullulans EXF-150] Length = 200 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 247 NAQQSAGDAGLPKQKGVSNDGQFDVLKDASA 155 NAQQSAGDAG+PKQ GVSNDGQFD LKD SA Sbjct: 170 NAQQSAGDAGIPKQGGVSNDGQFDALKDTSA 200