BLASTX nr result
ID: Forsythia21_contig00055984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055984 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099096.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] 78 3e-12 dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] 71 2e-10 ref|XP_011097241.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] 65 2e-08 gb|ACY82355.1| transcription factor cyclin D3b [Oreocharis dingh... 63 9e-08 >ref|XP_011099096.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] Length = 370 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = -1 Query: 161 EQESLVQNPAFDALYCEEECFNEDLRGGFGFQEREIENFDEIYKKPLAFLFEH 3 EQESL NP FDALYCEEE F+E GGFG +E EIE+F+EI +KP AFLFEH Sbjct: 7 EQESLHHNPIFDALYCEEERFDECAGGGFGLKEPEIEDFNEIQQKPFAFLFEH 59 >dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] Length = 372 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/55 (61%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 164 EEQESLVQNPAFDALYCEEECFNEDLRG-GFGFQEREIENFDEIYKKPLAFLFEH 3 +E ESL+QNP FDALYC+EE F+E + G G GF+E EI +F+EI+ P AFLFEH Sbjct: 6 QEHESLLQNPIFDALYCDEERFDECVGGAGSGFKEPEINDFNEIHNNPFAFLFEH 60 >ref|XP_011097241.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] Length = 367 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -1 Query: 164 EEQESLVQNPAFDALYCEEECFNEDLRGGFGFQEREIENFDEIYK-KPLAFLFEH 3 +EQ+ L+QNP FDALYCEEE F+EDL GG G + E+FD + + KP FLFEH Sbjct: 6 QEQDLLLQNPVFDALYCEEERFDEDLGGGLGLK----EDFDGVVREKPFGFLFEH 56 >gb|ACY82355.1| transcription factor cyclin D3b [Oreocharis dinghushanensis] Length = 163 Score = 62.8 bits (151), Expect = 9e-08 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -1 Query: 164 EEQESLVQNPAFDALYCEEECFNEDLRGGFGFQEREIENFDEIYKKPLAFLFE 6 +EQESL+QN FDALYCEEE +ED GF ++ EIE+F EI P +FLFE Sbjct: 1 QEQESLLQNSIFDALYCEEERIDEDSSTGFDLKKPEIEDFREICGNPPSFLFE 53