BLASTX nr result
ID: Forsythia21_contig00055944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055944 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073686.1| PREDICTED: adenylyl-sulfate kinase 3-like is... 62 1e-07 ref|XP_011073685.1| PREDICTED: adenylyl-sulfate kinase 3-like is... 62 1e-07 >ref|XP_011073686.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X2 [Sesamum indicum] Length = 301 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -2 Query: 215 MTSVGIRSLSLCKSSDLDFSEALCAKLRPVKVSILNCKCKKMGICGGETRSNLLEPIKAM 36 M ++G ++ LCKSS LDF +A+ AK P K + + KK+ ICGG RS+ L+PIKAM Sbjct: 1 MAALGNQTPGLCKSSVLDFFDAVHAKSTPSKAAAFRSRGKKLEICGGAARSSFLQPIKAM 60 Query: 35 DAS 27 +AS Sbjct: 61 EAS 63 >ref|XP_011073685.1| PREDICTED: adenylyl-sulfate kinase 3-like isoform X1 [Sesamum indicum] Length = 316 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/63 (49%), Positives = 43/63 (68%) Frame = -2 Query: 215 MTSVGIRSLSLCKSSDLDFSEALCAKLRPVKVSILNCKCKKMGICGGETRSNLLEPIKAM 36 M ++G ++ LCKSS LDF +A+ AK P K + + KK+ ICGG RS+ L+PIKAM Sbjct: 1 MAALGNQTPGLCKSSVLDFFDAVHAKSTPSKAAAFRSRGKKLEICGGAARSSFLQPIKAM 60 Query: 35 DAS 27 +AS Sbjct: 61 EAS 63