BLASTX nr result
ID: Forsythia21_contig00055822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055822 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY18173.1| putative calcofluor white hypersensitive protein ... 60 4e-07 >gb|KKY18173.1| putative calcofluor white hypersensitive protein [Phaeomoniella chlamydospora] Length = 143 Score = 60.5 bits (145), Expect = 4e-07 Identities = 36/64 (56%), Positives = 40/64 (62%), Gaps = 15/64 (23%) Frame = -3 Query: 294 QAKAAEA-----------KSRLSAYGKEAKAE----IDQFDAKVEKKTSEAKGGISSWLG 160 +AKAAEA K++ Y KEAKAE IDQFD VE+KTSEAK GISSW G Sbjct: 80 KAKAAEAEKAAEQYSKDGKAKFEKYSKEAKAELNATIDQFDKTVEQKTSEAKSGISSWFG 139 Query: 159 FGGK 148 FG K Sbjct: 140 FGKK 143