BLASTX nr result
ID: Forsythia21_contig00055746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055746 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851084.1| PREDICTED: leucine-rich repeat extensin-like... 59 1e-06 ref|XP_011093910.1| PREDICTED: leucine-rich repeat extensin-like... 58 3e-06 >ref|XP_012851084.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Erythranthe guttatus] Length = 418 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/46 (60%), Positives = 31/46 (67%), Gaps = 8/46 (17%) Frame = -2 Query: 198 KECSSDAAKPFDCSKSKC--------GGGGFAPKPIRTPPTSRKRP 85 KECSSDAAKPFDCSKSKC GGGGF P P + P ++K P Sbjct: 366 KECSSDAAKPFDCSKSKCAGSSGGGGGGGGFTPNPGKRTPVTQKPP 411 >ref|XP_011093910.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 784 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -2 Query: 201 AKECSSDAAKPFDCSKSKCGGGG-FAPKPIRTPPTSRKRP 85 A+ECSSDAAKPFDCSKSKCGGGG AP P R P + P Sbjct: 373 ARECSSDAAKPFDCSKSKCGGGGTVAPVPGRRGPVAPNPP 412