BLASTX nr result
ID: Forsythia21_contig00055592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00055592 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b... 58 3e-06 >ref|XP_008796519.1| PREDICTED: endoribonuclease Dicer homolog 3b-like [Phoenix dactylifera] Length = 1832 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +3 Query: 204 ISQNVVFFKNQYYFQQHVVSSSNLAQLISFDELTQPIERFKPD 332 +S+NVVFF NQY+FQ +V SSS+LA L SFD++ I+RFKP+ Sbjct: 143 VSRNVVFFDNQYFFQSNVASSSDLAMLPSFDDIYHSIKRFKPN 185