BLASTX nr result
ID: Forsythia21_contig00054458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00054458 (524 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010094620.1| putative CRM domain-containing protein [Moru... 57 1e-06 >ref|XP_010094620.1| putative CRM domain-containing protein [Morus notabilis] gi|587867008|gb|EXB56439.1| putative CRM domain-containing protein [Morus notabilis] Length = 506 Score = 57.0 bits (136), Expect(2) = 1e-06 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (2%) Frame = -1 Query: 221 KSYDRVPEKVLSCVLERR--KFLFIKSILLQICVLVVVNVRYIGTVVIYSHLTIDLHRGS 48 K+YDRVP +VL VLE+R +IK ++ + VV +VR G + I L++GS Sbjct: 162 KAYDRVPREVLWWVLEKRGVHVRYIK-VIKDMYDRVVTSVRTAGGYTAEFPIRIGLNQGS 220 Query: 47 ILSPYLFTIVMDDLT 3 LSPYLFTIVMD+LT Sbjct: 221 ALSPYLFTIVMDELT 235 Score = 21.9 bits (45), Expect(2) = 1e-06 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 256 ETRLDMIFIDLENPMIGCPRK 194 +T L M+FIDLE PR+ Sbjct: 150 KTDLHMVFIDLEKAYDRVPRE 170